DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINA3

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:424 Identity:106/424 - (25%)
Similarity:175/424 - (41%) Gaps:59/424 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLLSALLVGLAIA---------LTLPVDGELLARSPAS---------VSSN-RFGLRLTTKLGLT 50
            |:|..|.:||..|         ...|:|.|.|.:....         .|:| .|...|..:|.|.
Human     3 RMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLK 67

  Fly    51 QPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALE-----LTHASHPKLAVQDFETLLTDLKQ 110
            .||.||:.|||.|..||:.|   |...:.:.|.:.|:     ||..|..::. |.|:.||..|.|
Human    68 APDKNVIFSPLSISTALAFL---SLGAHNTTLTEILKGLKFNLTETSEAEIH-QSFQHLLRTLNQ 128

  Fly   111 SA-----AIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLS 170
            |:     ::|..:.:...|....|||       |......|.......::.::.|.:.||....:
Human   129 SSDELQLSMGNAMFVKEQLSLLDRFT-------EDAKRLYGSEAFATDFQDSAAAKKLINDYVKN 186

  Fly   171 RSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMF 235
            .:...:.:|:.  .|:|    .|..:.|:.:.|:|.|...|||.:|....|:....:..:|..|.
Human   187 GTRGKITDLIK--DLDS----QTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMS 245

  Fly   236 GQH-RYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEERKV 299
            ..| ...|.....|...::|:.: |.:...|.:.|:: |.:.::|..|....|.:.|..||.|::
Human   246 LHHLTIPYFRDEELSCTVVELKY-TGNASALFILPDQ-DKMEEVEAMLLPETLKRWRDSLEFREI 308

  Fly   300 A-LTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDG 363
            . |.|||..:....:|..:|.:||:.:.|||:..|    |.|..:....:..||...:|::.|:|
Human   309 GELYLPKFSISRDYNLNDILLQLGIEEAFTSKADL----SGITGARNLAVSQVVHKAVLDVFEEG 369

  Fly   364 GNADDSFSFGDLFRRALP-----LVINHPFFYAI 392
            ..|..:.:.......||.     :..|.||...|
Human   370 TEASAATAVKITLLSALVETRTIVRFNRPFLMII 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 96/376 (26%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 96/387 (25%)
RCL 369..394 4/24 (17%)
O-glycosylated at one site 381..389 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.