DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinc1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_543120.1 Gene:Serpinc1 / 11905 MGIID:88095 Length:465 Species:Mus musculus


Alignment Length:480 Identity:104/480 - (21%)
Similarity:182/480 - (37%) Gaps:115/480 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSALLV---GLAIALTLPVDGELLA-------------RSPA---------------------- 32
            |||.||:   |.||....|||...:|             |||.                      
Mouse    18 LLSLLLIGALGCAICHGNPVDDICIAKPRDIPVNPLCIYRSPGKKATEEDGSEQKVPEATNRRVW 82

  Fly    33 --SVSSNRFGLRLTTKLGLTQPD-ANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHP 94
              |.:::||.......|..::.| .|:.:|||.|..|.::....:.::   .|:|.:|       
Mouse    83 ELSKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACND---TLKQLME------- 137

  Fly    95 KLAVQDFETLLTDLKQS-----AAIGCRL----RLLSDLYAQQR------FTFN--FRNEFETLA 142
               |..|:|:.......     |.:.|||    ...|||.:..|      .|||  :::..|.: 
Mouse   138 ---VFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSDLVSANRLFGDKSLTFNESYQDVSEVV- 198

  Fly   143 ARMGVGCHRLSW-ESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAP 206
              .|.....|.: |:...:...||....:::...:.:::....:..|    |..:.|:.:.|:..
Mouse   199 --YGAKLQPLDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAINEL----TALVLVNTIYFKGL 257

  Fly   207 WAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNR 271
            |...|.|..|:...|:....:...|..|:.:.:::|..| |...|::|:||...|:.|:::.|..
Mouse   258 WKSKFSPENTRKEPFYKVDGQSCPVPMMYQEGKFKYRRV-AEGTQVLELPFKGDDITMVLILPKP 321

  Fly   272 PDGLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSE------ 330
            ...||::|::|....|.:...:|.|..:.:.:|:.|......||..|:::||..||:.|      
Mouse   322 EKSLAKVEQELTPELLQEWLDELSETMLVVHMPRFRTEDGFSLKEQLQDMGLIDLFSPEKSQLPG 386

  Fly   331 --------VHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALP----LV 383
                    :::|:.|               ....||:.|:|..|..|.|.....|...|    ..
Mouse   387 IVAGGRDDLYVSDAF---------------HKAFLEVNEEGSEAAASTSVVITGRSLNPNRVTFK 436

  Fly   384 INHPFFYAIGNG--KTLLLSGHIVD 406
            .|.||...|...  .|::..|.:.:
Mouse   437 ANRPFLVLIREVALNTIIFMGRVAN 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 88/407 (22%)
Serpinc1NP_543120.1 serpinC1_AT3 71..464 CDD:381002 89/427 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.