DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb7

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_569088.1 Gene:Serpinb7 / 117092 RGDID:71063 Length:380 Species:Rattus norvegicus


Alignment Length:393 Identity:83/393 - (21%)
Similarity:176/393 - (44%) Gaps:41/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELT------HA 91
            :.::..||..|..::..:|.:.||..|.|.|..||||:...:..:...|:.:||...      ::
  Rat     5 AAANAEFGFDLFREMDSSQGNGNVFFSSLSIFTALSLIRLGARGDCARQIDKALHFISPSRQGNS 69

  Fly    92 SHPKLAVQ-DFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWE 155
            |:.:|.:| ..:.:|.|:..|.. ...|.:.:.::|::.|.|: ::..|...........|:.: 
  Rat    70 SNSQLGLQYQLKRVLADINSSHK-DYELSIANGVFAEKVFDFH-KSYMECAENLYNAKVERVDF- 131

  Fly   156 SASNAAQD----INYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTET 216
              :|..|:    ||....:.::..:.:::....|.|.|    ..:.|:.|.|:..|..||..::|
  Rat   132 --TNDIQETRFKINKWIENETHGKIKKVLGDSSLSSSA----VMVLVNAVYFKGKWKSAFTKSDT 190

  Fly   217 QSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERK 281
            .|.:|.:.....:.|:.|..:.|:..:.:.....|::|:.: ...:.|.|:.|.  |.|:::|.|
  Rat   191 LSCHFRSPSGPGKAVNMMHQERRFNLSTIQEPPMQILELQY-HGGISMYIMLPE--DDLSEIESK 252

  Fly   282 LAQSDL------HQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSI 340
            |:..:|      .:::||.    |.:.||:.::....:::..|:.:||..:|   |......|.|
  Rat   253 LSFQNLMDWTNSRKMKSQY----VNVFLPQFKIEKDYEMRSHLKSVGLEDIF---VESRADLSGI 310

  Fly   341 LSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALP----LVINHPFFYAIGNGKTLLLS 401
            .|.....:..::...|:|:.|:|..| .:.:..::..:.||    ...:.||.:.|.....:|.:
  Rat   311 ASGGRLYVSKLMHKSLIEVSEEGTEA-TAATESNIVEKLLPESTVFRADRPFLFVIRKNGIILFT 374

  Fly   402 GHI 404
            |.:
  Rat   375 GKV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 83/389 (21%)
Serpinb7NP_569088.1 SERPIN 4..380 CDD:294093 83/393 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.