DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and LOC100909605

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:400 Identity:85/400 - (21%)
Similarity:153/400 - (38%) Gaps:71/400 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SPASVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHP 94
            |..|..:..|...|..:|.|..||.|:|.|...|..||.||...:.:....::.:.|:......|
  Rat    35 STLSSCNTDFAFSLYKELVLKNPDKNIVFSSFSISTALVLLSLGAKNNTLKEILEGLKFNLTETP 99

  Fly    95 KLAV-QDFETLLTDLK-----------QSAAIGCRLRLLSD-------LYAQQRFTFNFRNEFET 140
            :..: |.:|.||..|.           .:..|...|::|::       ||..:.|:.:|:...| 
  Rat   100 EAEIHQGYEHLLQRLNLPGDQVQISTGSALFIKKHLQILAEFQEKARALYQAEAFSTDFQQPHE- 163

  Fly   141 LAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRA 205
                               |.:.||.....::...:.||:      |:.:..|..:.|:.:.|:.
  Rat   164 -------------------AKKLINDYVRKQTQGKIKELI------SVLDKKTSMVLVNYIYFKG 203

  Fly   206 PWAWAFDPTETQSINFFAGGNRPRLVDAM-FGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFP 269
            .|...|||.:|....|:....:...|..| ..:....|.....|...::|:.: |.:...|.:.|
  Rat   204 KWKMPFDPHDTFQSEFYLDEKKSVKVPMMKIEKLTTPYFRDEELSCSVLELKY-TGNASALFILP 267

  Fly   270 NRPDGLAQLERKLAQSDLHQLRSQLEERKV-ALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHL 333
            :: ..:.|:|..|....|.:.:..|..|:: .|.:||..:.....|..:|.|||:.::|:.:..|
  Rat   268 DQ-GRMQQVEASLQPETLRRWKDTLRPRRIDELRMPKFSISTDMRLGDILPELGIREVFSQQADL 331

  Fly   334 SEVFSSILSSSAPPLGA--VVQSGLLELQEDGGNADDSFSFGDLFRRALP---------LVINHP 387
            |.:      :.|..|..  ||...:|::.|.|..|..:...     :.:|         :..|.|
  Rat   332 SRI------TGAKDLSVSQVVHKAVLDVTETGTEAAAATGV-----KIIPMCAKFYYVTMYFNRP 385

  Fly   388 FFYAIGNGKT 397
            |...|.:..|
  Rat   386 FLMIISDTNT 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 82/394 (21%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 82/393 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.