DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP721A1

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_177649.1 Gene:CYP721A1 / 843850 AraportID:AT1G75130 Length:505 Species:Arabidopsis thaliana


Alignment Length:450 Identity:104/450 - (23%)
Similarity:194/450 - (43%) Gaps:78/450 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EFYERTRQH-----KLVG-----FFNMRTPMITLNDPELIKKVCVK--DFDHFPNHQPFITSNDR 113
            ||..|...|     ::.|     :|..: |::..:||.||::....  .||.. .|.|.   :..
plant    73 EFVHRVAPHYHEWSRVYGKTFLYWFGSK-PVVATSDPRLIREALTTGGSFDRI-GHNPL---SKL 132

  Fly   114 LFNDMLSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDM 178
            |:...|..:|..:|...|......||..|::.....|..|....::..:....   |.:..|:::
plant   133 LYAQGLPGLRGDQWAFHRRIAKQAFTMEKLKRWVPQMVTSTMMLMEKWEDMRN---GGEEIELEV 194

  Fly   179 KVMCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQSL----------VFSRGLQFFKFMLSTLV 233
            ....:.||.::::.||||   ||.:..|. .:|:.:.:          |:..|.:||....:..:
plant   195 HKEMHNLSAEMLSRTAFG---NSVEEGKG-IFELQERMMRLFYLVRWSVYIPGFRFFPSKTNREI 255

  Fly   234 PKLFSLLKLTIFDSAKVDYFARLVVEAMQYREKHNITRPDMIQLLMEA-------KNESEDKWTD 291
            .::...::::|.         :|:        ::|.|..:....|::|       :|..|:|...
plant   256 WRIEKQIRVSIL---------KLI--------ENNKTAVEKSGTLLQAFMSPYTNQNGQEEKLGI 303

  Fly   292 DEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIV----ETKKALNGAPLTYDAVQ 352
            :|:..:|..|:|||.|..:||:......|..|.:.|....||::    :|     |.| |.|.:|
plant   304 EEVTDECKTFYFAAKETTANLMTFVLVLLAMNQEWQNIAREEVICVLGQT-----GLP-TLDILQ 362

  Fly   353 KMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLD-DRYFP 416
            .:..:.|:|:|:||.:..|...:|...|...|.|      .|...|.::.:.:..:|.| :.:..
plant   363 DLKTLSMIINETLRLYPPAMTLNRDTLKRAKLGD------LDIPAGTQLYLSVVAMHHDKETWGD 421

  Fly   417 EPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEASP 476
            :..:|:|.||.:.:|...:   .:|||:|||.|:|...|:.:.|.:|..:|.:|....||
plant   422 DAEEFNPRRFEDPKKQSAL---LVPFGLGPRTCVGQNLAVNEAKTVLATILKYYSFRLSP 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 103/449 (23%)
CYP721A1NP_177649.1 p450 26..495 CDD:386267 103/449 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.