DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP72C1

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:183 Identity:45/183 - (24%)
Similarity:77/183 - (42%) Gaps:43/183 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKHMRNTLTPVFTAAKMR 144
            |.:.:.|||.::::..| .:.||  :|.|.|::.:|...|......:|...|:.|.|.|....::
plant   106 PNVIVMDPETLREIMSK-HELFP--KPKIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLK 167

  Fly   145 NMFTLMNESFAECLQHLDSSSKTLPGRKG-FEVDMKVMCNKLSNDIIATTAFGLKVNSY-DNPKN 207
            ::....|.|..|.|:..:    .|...|| .|:|....|:.|:.:::|..:||   :|| |..| 
plant   168 SILPAFNSSCKEMLEEWE----RLASAKGTMELDSWTHCHDLTRNMLARASFG---DSYKDGIK- 224

  Fly   208 EFYEIGQSLV---------------------FSRGLQ--------FFKFMLST 231
             .:||.|..:                     |:|.|:        .||.|:.|
plant   225 -IFEIQQEQIDLGLLAIRAVYIPGSKFLPTKFNRRLRETERDMRAMFKAMIET 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 45/183 (25%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.