DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP97B3

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_193247.2 Gene:CYP97B3 / 827177 AraportID:AT4G15110 Length:580 Species:Arabidopsis thaliana


Alignment Length:435 Identity:99/435 - (22%)
Similarity:181/435 - (41%) Gaps:81/435 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 WKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSS-------KTLPGRKGFEVDMKVMCNK 184
            ||..|..:||.|....:..|..:    |::|.:.:...|       :|..|....|:|::...:.
plant   168 WKLRRRAITPAFHKLYLEAMVKV----FSDCSEKMILKSEKLIREKETSSGEDTIELDLEAEFSS 228

  Fly   185 LSNDIIATTAFGLKVNSYD----NPKNEFYEIGQSLVFS---RGLQFFKFM----LSTLVP---K 235
            |:.|||     ||.|.:||    ..::...:.....:|.   |...:|.:.    ...:||   |
plant   229 LALDII-----GLSVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYFPYWNFPPARWIVPRQRK 288

  Fly   236 LFSLLKLT------IFDSAKVDYFARLVVEAMQYREKHNITRPDMIQLLMEAKN-ESEDKWTDDE 293
            ..|.||:.      :..:|| :......||.:|.|:..|:....:::.|::.:. :.:|:...|:
plant   289 FQSDLKIINDCLDGLIQNAK-ETRQETDVEKLQERDYTNLKDASLLRFLVDMRGVDIDDRQLRDD 352

  Fly   294 IVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMD 358
            ::.    ...|..|..:.::....:.|..||   |::.:...|....|...|.||::::|:.|:.
plant   353 LMT----MLIAGHETTAAVLTWAVFLLSQNP---EKIRKAQAEIDAVLGQGPPTYESMKKLEYIR 410

  Fly   359 MVISESLRKWTLAAATDRLCSKDYTLT-----DDDGTKLFDFKVGDRINIPISGLHLDDRYFPEP 418
            :::.|.||.:.......|...|..||.     :.:|.|:   ..|..|.|.:..||....::..|
plant   411 LIVVEVLRLFPQPPLLIRRTLKPETLPGGHKGEKEGHKV---PKGTDIFISVYNLHRSPYFWDNP 472

  Fly   419 RKFDPDRFSEERK----------------GDMVP------YTYLPFGVGPRNCIGNRYALMQVKG 461
            ..|:|:||...::                |.:.|      :.:||||.|||.|||:::|||:...
plant   473 HDFEPERFLRTKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTV 537

  Fly   462 MLFNLLLHYKIE--ASPRTIKDLWGSASGFNFTPRSGFWMHLVPR 504
            .|..|...:.:|  .:|.:::    ..||.....::|.|..|..|
plant   538 ALAMLFQKFDVELRGTPESVE----LVSGATIHAKNGMWCKLKRR 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 93/407 (23%)
CYP97B3NP_193247.2 PLN02738 45..580 CDD:215393 99/435 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.