DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP709B2

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 / 819309 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana


Alignment Length:433 Identity:118/433 - (27%)
Similarity:186/433 - (42%) Gaps:86/433 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PMITLNDPELIKKVCVKDFDHFPNH--QPFI---TSNDRLFNDMLSVMRDQRWKHMRNTLTPVFT 139
            |.:.::|.||.|::....|..|...  :|.|   :.|..:|.:.|.      |...|..|.|.|:
plant   161 PRLCISDHELAKQILSNKFVFFSKSKTKPEILKLSGNGLIFVNGLD------WVRHRRILNPAFS 219

  Fly   140 AAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCN----KLSNDIIATTAFGLKVN 200
            ..|::    ||.:...:|...:....|  ..|.|.|.:..|:.:    :|:.|||||.|||   :
plant   220 MDKLK----LMTQLMVDCTFRMFLEWK--KQRNGVETEQFVLISREFKRLTADIIATAAFG---S 275

  Fly   201 SYDNPKNEFYEIGQSLVFSRGLQFFKFMLS-----------------TLVPKLFSL----LKLTI 244
            ||                :.|::.||..|.                 ..:|...:|    |.:.:
plant   276 SY----------------AEGIEVFKSQLELQKCCAAALTDLYFPGIQYLPTPSNLQIWKLDMKV 324

  Fly   245 FDSAKVDYFARLVVEAMQYREKHNITRPDMIQLLMEA--KNESEDKWTDDEIVAQCFIFFFAAFE 307
            ..|.|....|||..|:..|..       |::.:::.|  .||||.|.:.|||:.:|..||||..|
plant   325 NSSIKRIIDARLTSESKDYGN-------DLLGIMLTAASSNESEKKMSIDEIIEECKTFFFAGHE 382

  Fly   308 NNSNLICTTTYELLYNPDVQERLYEEIVET--KKALNGAPLTYDAVQKMTYMDMVISESLRKWTL 370
            ..:||:..:|..|..:.|.||:|.||:...  |..:..|    :...|:..|:.|..||||.:..
plant   383 TTANLLTWSTMLLSLHQDWQEKLREEVFNECGKDKIPDA----ETCSKLKLMNTVFMESLRLYGP 443

  Fly   371 AAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYF-PEPRKFDPDRFSE--ERKG 432
            .....||.|:|..|.:      .:...|..|.:||:.:|.|...: .:..||:|.||:.  .|..
plant   444 VLNLLRLASEDMKLGN------LEIPKGTTIILPIAKMHRDKAVWGSDADKFNPMRFANGLSRAA 502

  Fly   433 DMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEAS 475
            :. |...|.|.:|||.|||..:|:|:.|.:|..:|..:::..|
plant   503 NH-PNALLAFSMGPRACIGQNFAIMEAKTVLAMILQRFRLNLS 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 118/433 (27%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 118/433 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.