DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_077764.2 Gene:Cyp4f18 / 72054 MGIID:1919304 Length:524 Species:Mus musculus


Alignment Length:465 Identity:107/465 - (23%)
Similarity:184/465 - (39%) Gaps:84/465 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PMITLNDPELIKKVCV-------KDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKHMRNTLTPV 137
            |:|.:..|..||.|.:       ||...:...:|::       .|.|.:....:|...|..|||.
Mouse    97 PVIRIFHPAFIKPVVLAPALVAPKDTVFYRFLKPWL-------GDGLLMSTGDKWSRHRRMLTPA 154

  Fly   138 FTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTAFGLKVNSY 202
            |....::....:.|:|    ...:.:..:.|..:....::|....:.::.|.:....|....|..
Mouse   155 FHFNILKPYVKVFNDS----TNIMHAKWQRLASKGSAYLNMFEHISLMTLDSLQKCVFSFDSNCQ 215

  Fly   203 DNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAMQYREK- 266
            :.|......|              ..|||||.:....|.|      .||.|..|..:.|::|:. 
Mouse   216 EKPSEYITAI--------------LELSTLVARRHQRLLL------HVDLFYYLTHDGMRFRKAC 260

  Fly   267 ---HNITRP---------------------------DMIQLLMEAKNESEDKWTDDEIVAQCFIF 301
               |:.|..                           |.|.:|:.:|:|.....:|::|.|:...|
Mouse   261 RLVHDFTDAVIRERRRTLLDQGGVDVLKAKAKAKTLDFIDVLLLSKDEHGKALSDEDIRAEADTF 325

  Fly   302 FFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLR 366
            .|...:..::.:....|.|..:|:.|||..:|:.|..:......:.:|.:.::.::.|.|.||||
Mouse   326 MFGGHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLR 390

  Fly   367 KWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERK 431
            ......|..|.|::|..|.|.   ::....|..||:  |.|.|.:...:|:|..:||.||..:..
Mouse   391 LHPPVTAISRCCTQDIVLPDG---RVIPKGVISRIS--IFGTHHNPAVWPDPEVYDPFRFDADNV 450

  Fly   432 GDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI---EASPRTIKDLWGSASGFNFTP 493
            ....|..::||..|||||||..:|:.::|..|...||.:::   :..||...:|...|.|     
Mouse   451 KGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRVLPDDKEPRRKPELILRAEG----- 510

  Fly   494 RSGFWMHLVP 503
              |.|:.:.|
Mouse   511 --GLWLKVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 100/438 (23%)
Cyp4f18NP_077764.2 p450 52..516 CDD:365848 106/461 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.