DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4f37

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001093657.1 Gene:Cyp4f37 / 677156 MGIID:3780112 Length:546 Species:Mus musculus


Alignment Length:460 Identity:104/460 - (22%)
Similarity:179/460 - (38%) Gaps:74/460 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKHMRNTLTPVFTAAKMR 144
            |::.:.||..:..:.:......|....|.|.......|.|.:....:|...|..|||.|....::
Mouse    97 PVLRIVDPAFVAPLLLASALVAPKDTTFHTFVKPWLGDGLFLNSGDKWSRHRRLLTPAFHFDILK 161

  Fly   145 NMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTAFGLKVNSYDNPKNEF 209
            ....:.|:|    :..:.:..|.|.......::|....:.::.|.:....||...|..::|....
Mouse   162 PYVKIFNQS----VNIMHAKWKHLSSEGSARLEMFEHISLMTLDSLQKCLFGFDSNCQESPSEYI 222

  Fly   210 YEIGQ--SLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAMQYREK----HN 268
            ..|.:  |||..|..|.|.|                      ||:......:..::|:.    ||
Mouse   223 SAILELSSLVIKRSHQLFLF----------------------VDFLYYHTADGRRFRKACDLVHN 265

  Fly   269 ITRP---------------------------DMIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAF 306
            .|..                           |.|.:|:.||:|...:.:|::|.|:...|.|...
Mouse   266 FTDAVIRERRHTLSSQNHDEFLKSKTKSKTLDFIDVLLLAKDEHGKELSDEDIRAEADTFMFGGH 330

  Fly   307 ENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLA 371
            :..::.:....|.|..:|:.|||..:|:.|..:......:.:|.:.::.::.|.|.||||.....
Mouse   331 DTTASALSWILYNLARHPEYQERCRQEVQELLRGREPQEIEWDDLAQLPFLTMCIKESLRLHPPV 395

  Fly   372 AATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVP 436
            ....|.|::|..|  .||..:   ..|:...|.|.|:|.:...:|:|..:||.||..|......|
Mouse   396 IDLLRRCTRDIVL--PDGRVI---PKGNICVISIFGIHHNPSVWPDPEVYDPFRFDPENAHKRPP 455

  Fly   437 YTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI---EASPRTIKDLWGSASGFNFTPRSGFW 498
            ..::||..|||||||..:|:.::...|...||.::|   :..||...::...|.|       |.|
Mouse   456 LAFIPFSAGPRNCIGQTFAMNEMMVALALTLLRFRILPDDKEPRRKPEIILRAEG-------GLW 513

  Fly   499 MHLVP 503
            :.:.|
Mouse   514 LRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 98/433 (23%)
Cyp4f37NP_001093657.1 CYP4F 74..515 CDD:410772 103/455 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.