DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP4F12

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:545 Identity:123/545 - (22%)
Similarity:211/545 - (38%) Gaps:93/545 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ICLALVVIGYL---IYKWSTATFKTFEERKLYFEKPYP-----FVGNMAAAALQKSSFQR--QLT 60
            :.|.|||..:|   |..|:.|.:......:.:   |.|     |.|::......:...:.  |::
Human    20 LLLLLVVGSWLLARILAWTYAFYNNCRRLQCF---PQPPKRNWFWGHLGLITPTEEGLKNSTQMS 81

  Fly    61 EFYERTRQHKLVGF---FNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLF------- 115
            ..|.:       ||   .....|.|.|..|:.|:.:        .|....|...|.||       
Human    82 ATYSQ-------GFTVWLGPIIPFIVLCHPDTIRSI--------TNASAAIAPKDNLFIRFLKPW 131

  Fly   116 -NDMLSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNES---FAECLQHLDSSSKTLPGRKGFEV 176
             .:.:.:....:|...|..|||.|....:::..|:.|:|   ..:..|||.|...:       .:
Human   132 LGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSS-------RL 189

  Fly   177 DMKVMCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQ--SLVFSRGLQFFKFMLSTLVPKLFSL 239
            ||....:.::.|.:....|....:..:.|......|.:  :||..|.....:.|         ..
Human   190 DMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHILQHM---------DF 245

  Fly   240 LKLTIFDSAKVDYFARLVVEAMQ------------------YREKHNITRPDMIQLLMEAKNESE 286
            |.....|..:.....|||.:...                  :::|......|.|.:|:.:|:|..
Human   246 LYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDG 310

  Fly   287 DKWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAV 351
            ...:|::|.|:...|.|...:..::.:....|.|..:|:.|||..:|:.|..|..:...:.:|.:
Human   311 KALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWDDL 375

  Fly   352 QKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFP 416
            .::.::.|.:.||||....|....|.|::|..|  .||..:   ..|....|.|.|:|.:...:|
Human   376 AQLPFLTMCVKESLRLHPPAPFISRCCTQDIVL--PDGRVI---PKGITCLIDIIGVHHNPTVWP 435

  Fly   417 EPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI---EASPRT 478
            :|..:||.||..|......|..::||..|||||||..:|:.::|.:|..:|||::.   ...||.
Human   436 DPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRR 500

  Fly   479 IKDLWGSASGFNFTPRSGFWMHLVP 503
            ..:|...|.|       |.|:.:.|
Human   501 KLELIMRAEG-------GLWLRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 108/484 (22%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 110/489 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.