DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4f1

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_062569.2 Gene:Cyp4f1 / 56266 RGDID:70926 Length:524 Species:Rattus norvegicus


Alignment Length:508 Identity:117/508 - (23%)
Similarity:197/508 - (38%) Gaps:96/508 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RQLTEFYERTRQHKLVGFFNMRT----------------------------PMITLNDPELIKK- 92
            |:|..|.:..:::.|:|...|.|                            |:|||...::::. 
  Rat    46 RRLRGFPQPPKRNWLMGHVGMVTPTEQGLKELTRLVGTYPQGFLMWIGPMVPVITLCHSDIVRSI 110

  Fly    93 ------VCVKDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMN 151
                  |.:||...:...:|::       .|.|.|....:|...|..|||.|....::....:.|
  Rat   111 LNASAAVALKDVIFYTILKPWL-------GDGLLVSAGDKWSRHRRMLTPAFHFNILKPYVKIFN 168

  Fly   152 ESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQ-- 214
            :|    ...:.:..|.|.......:||....:.::.|.:....|....|..:........|.:  
  Rat   169 DS----TNIMHAKWKRLISEGSSRLDMFEHVSLMTLDSLQKCVFSFDSNCQEKSSEYIAAILELS 229

  Fly   215 SLVFSRGLQFFKFM--LSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAMQ--YREKHNITRP--- 272
            :||..|..|...||  |..|.|           |..:......||.|...  .||:.. |.|   
  Rat   230 ALVAKRHQQPLLFMDLLYNLTP-----------DGMRFHKACNLVHEFTDAVIRERRR-TLPDQG 282

  Fly   273 --------------DMIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYN 323
                          |.|.:|:..|:|...:.:|::|.|:...|.|...:..::.:....|.|..:
  Rat   283 LDEFLKSKAKSKTLDFIDVLLLTKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLAKH 347

  Fly   324 PDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDD 388
            |:.|||..:|:.|..:..:...:.:|.:.::.::.|.|.||||.........|.|::|..|  .|
  Rat   348 PEYQERCRQEVQELLRDRDPEEIEWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILL--PD 410

  Fly   389 GTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNR 453
            |..:   ..|....|.|.|:|.:...:|:|..::|.||..|...|..|..::||..|||||||..
  Rat   411 GRTI---PKGIICLISIFGIHHNPSVWPDPEVYNPFRFDPENIKDSSPLAFIPFSAGPRNCIGQT 472

  Fly   454 YALMQVKGMLFNLLLHYKI---EASPRTIKDLWGSASGFNFTPRSGFWMHLVP 503
            :|:.::|..|...||.:::   :..||...:|...|.|       |.|:.:.|
  Rat   473 FAMSEMKVALALTLLRFRLLPDDKEPRRQPELILRAEG-------GLWLRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 110/481 (23%)
Cyp4f1NP_062569.2 CYP4F 74..515 CDD:410772 109/475 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.