DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4c3

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster


Alignment Length:561 Identity:137/561 - (24%)
Similarity:232/561 - (41%) Gaps:92/561 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALIEICLALVVIGYLIYKWSTAT----------FKTFEERK----LYFEK-----PYPFVGNMAA 47
            :|:...:.|..:|.:|..:|..|          ...:.:|:    .|.||     ..||:||   
  Fly     8 SLMAESILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGN--- 69

  Fly    48 AALQKSSFQRQLTEFYERTRQHKLVG-------FFNMRTPMITLNDPELIKKVCVKDFDHFPNHQ 105
             |::.:....:|  |.......||.|       .:....|.:.|.:||.::.:.        |.|
  Fly    70 -AIEMNVDHDEL--FNRVIGMQKLWGTRIGINRVWQGTAPRVLLFEPETVEPIL--------NSQ 123

  Fly   106 PFITSN---DRL---FNDMLSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSS 164
            .|:..:   |.|   ..:.|....|::|...|..|||.|....:.:...:.||..|...:.|   
  Fly   124 KFVNKSHDYDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLARKL--- 185

  Fly   165 SKTLPGRKGFEVDMKV-MCNKLSNDIIATTAFGLKVNSYDNPKNEF----YEIGQSLVFSRGLQF 224
             ....|.:.|.:...| :|   :.||:..||.|.::.:..|.::|:    |.|| |:|.||..:.
  Fly   186 -AVEVGSEAFNLFPYVTLC---TLDIVCETAMGRRIYAQSNSESEYVKAVYGIG-SIVQSRQAKI 245

  Fly   225 FKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVE--------AMQYREKHNITRPD-------- 273
              ::.|..:..|.:..||.......:..|:.:|:.        ..:....:|...||        
  Fly   246 --WLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKK 308

  Fly   274 ----MIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEI 334
                .:.||::|..|. ...::::|..:...|.|...:..|..|..|.:.|..:|:.|||:.||:
  Fly   309 KRLAFLDLLIDASKEG-TVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEEL 372

  Fly   335 VETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGD 399
            ..........|.|...:..|.|::..|.:|||.:.......|:..:|..:    |.|:  ...|.
  Fly   373 DSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI----GGKI--VPAGT 431

  Fly   400 RINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLF 464
            :..|....||.:.|.||:|.:|:||.|..|......|:.|:||..|||||||.::|:::.|.::.
  Fly   432 QAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVIS 496

  Fly   465 NLLLHYKIEASPRTIKDLWGSASG-FNFTPRSGFWMHLVPR 504
            .:|..|||||..|. :||  :..| ....|:.|..:.:.||
  Fly   497 TVLRKYKIEAVDRR-EDL--TLLGELILRPKDGLRVKITPR 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 120/483 (25%)
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 125/505 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.