DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4e2

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster


Alignment Length:492 Identity:106/492 - (21%)
Similarity:208/492 - (42%) Gaps:54/492 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IEICLALVVIGYLIYKWSTATFKTFEERKLY--FEKP--YPFVGNMAAAALQKSSFQRQLTEFYE 64
            |.:.|.|:::.||       ...||..|::.  |..|  .|.:||........|.....:..::.
  Fly     7 IFLALPLLLVAYL-------ELSTFRRRRVLNKFNGPRGLPLMGNAHQMGKNPSEILDTVFSWWH 64

  Fly    65 RTRQHKLVGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSND--RLFNDMLSV----MR 123
            :..:...|.:....:.::..:.         |..:...:.|..||.:|  :|.:..|.:    ..
  Fly    65 QYGKDNFVFWIGTYSNVLVTSS---------KYLEFILSSQTLITKSDIYQLTHPWLGLGLLTST 120

  Fly   124 DQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSND 188
            ..:|...|..:||.|....:::...:|||:..:.::||    ||:...... .|.:...:.|:.|
  Fly   121 GSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIKHL----KTVAAGDNI-FDFQEQAHYLTLD 180

  Fly   189 IIATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQFF-----KFMLSTLVP--KLFSLLKLTIFD 246
            :|..||.|:.:|:.:|..:...:..:.:.::..::.|     ..:|..|.|  ..:|....|:.|
  Fly   181 VICDTAMGVSINAMENRSSSIVQAFKDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRTLKTLQD 245

  Fly   247 SAKVDYFARLVVE---AMQYREKHNITRPDM--IQLLMEAKNESEDKWTDDEIVAQCFIFFFAAF 306
            ........|:...   |:........||..|  :..|:.:..:.. .....|:..:...|.|...
  Fly   246 FTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSSTIDGR-PLNSKELYEEVSTFMFEGH 309

  Fly   307 ENNSNLICTTTYELLYNPDVQERLYEEIVETK-KALNGAPLTYDAVQKMTYMDMVISESLRKWTL 370
            :..::.:....|.|..:.|.|.:|::|..|.. .:..|...|:..:.:|.|:|:.|.|:.|.:..
  Fly   310 DTTTSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATFQEISQMKYLDLFIKEAQRVYPS 374

  Fly   371 AAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMV 435
            .....|...|||.:..|...|      |..:|:.:..|..:::.|.:|.||.|:||..|:.|   
  Fly   375 VPFIGRFTEKDYVIDGDLVPK------GTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKPG--- 430

  Fly   436 PYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI 472
            |:.|:||..|||||||.::||:::|.::..::.::::
  Fly   431 PFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEV 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 97/457 (21%)
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 97/457 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.