DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4e3

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster


Alignment Length:499 Identity:122/499 - (24%)
Similarity:220/499 - (44%) Gaps:71/499 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVVIGYLIYKWSTATF---KTFEERKLYFE----KPYPFVGNMAAAALQKSSFQRQLTEF---YE 64
            |.|:..|:....|..:   |..:.|:|..|    .|.|.:||  |..:.|:..:...|.|   |:
  Fly     3 LAVLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGN--ANRIGKNPAEILSTFFDWWYD 65

  Fly    65 RTRQHKL--VGFFN---MRTPM---ITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSV 121
            ..:.:.|  :|:.:   |..|.   ..||..:||:|..:.|..|     |::...       |..
  Fly    66 YGKDNFLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYDLLH-----PWLGHG-------LLT 118

  Fly   122 MRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLD--SSSKTLPGRKGFEVDMKVMCNK 184
            ....:|...|..:||.|....:::...:|||:.|:.:..|.  |:..|:       :|.:...|.
  Fly   119 SFGSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTI-------IDFQEHANY 176

  Fly   185 LSNDIIATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQ-FFKFMLS----TLVPKLFSLLKLTI 244
            |:.|:|..||.|:.:|:.:...:...:..:.:.::..:: |..|..|    :|.|: ||..:.|:
  Fly   177 LTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPE-FSAYQKTL 240

  Fly   245 FDSAKVDYFARLVVEAMQY-------REKHNITRP----DMIQLLMEAKNESEDKWTDDEIVAQC 298
               ..:..|...::|...|       :|.|:.:.|    ..:..|:.:..:.. ..|..||..:.
  Fly   241 ---KTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGR-PLTRQEIYEEV 301

  Fly   299 FIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISE 363
            ..|.|...:..::.:..:.|.|..:||||.:||.|..|.........:::..:.||.|:|:.|.|
  Fly   302 STFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKE 366

  Fly   364 SLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSE 428
            :.|.:.......|.|.|||.:......|      |..:|:.:..|..:||.|.:|..|.|:||.|
  Fly   367 AQRVYPSVPFIGRYCDKDYDINGSIVPK------GTTLNLALILLGYNDRIFKDPHHFRPERFEE 425

  Fly   429 ERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI 472
            |:.   .|:.||||..|||||||.::||:::|.::..::..:::
  Fly   426 EKP---APFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEV 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 114/465 (25%)
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 114/467 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.