DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_796281.1 Gene:Cyp4f39 / 320997 MGIID:2445210 Length:532 Species:Mus musculus


Alignment Length:552 Identity:113/552 - (20%)
Similarity:208/552 - (37%) Gaps:110/552 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVVIGYLIYKWSTATFKTFEERKLYFEK----PYP-----FVGNMAAAALQKSSFQRQLTEFYER 65
            |:::.:..::.....||.|.:.::...|    |.|     .:|:|:.....:...|.:....  .
Mouse    28 LLLVLFFFFRLLVRAFKLFSDFRITCRKLSCFPEPPGRHWLLGHMSMYLPNEKGLQNEKKVL--D 90

  Fly    66 TRQHKLVGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKHM 130
            |..|.::.:.....|::.|..|:.||.|........|..:.|.:.......|.|.:.:..:|...
Mouse    91 TMHHIILAWVGPFLPLLVLVHPDYIKPVLGASAAIAPKDEFFYSFLKPWLGDGLLISKGNKWSRH 155

  Fly   131 RNTLTPVFTAAKMRNMFTLMNE----SFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIA 191
            |..|||.|....::....:.|:    ..|:..:||...|.|       ..||....:.::.|.:.
Mouse   156 RRLLTPAFHFDILKPYMKIFNQCTNIMHAKWRRHLAEGSVT-------SFDMFEHISLMTLDSLQ 213

  Fly   192 TTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAK----VDY 252
            ...|     ||::...|                   .:|..:..:..|..|.:....:    :|:
Mouse   214 KCVF-----SYNSDCQE-------------------RMSDYISSIIELSALVVRRQYRLHHYLDF 254

  Fly   253 FARLVVEAMQYREK----HNITRP--------------------------DMIQLLMEAKNESED 287
            ...|..:..::|:.    ||.|..                          |.|.:|:.||:|...
Mouse   255 MYYLTADGRRFRQACDTVHNFTTEVIQERRQALRQQGAEAWLKAKQGKTLDFIDVLLLAKDEEGK 319

  Fly   288 KWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQ 352
            :.:|::|.|:...|.|...:..|:.:....:.|...|:.||:..|||.|..|......|.:|.:.
Mouse   320 ELSDEDIRAEADTFMFEGHDTTSSGLSWALFNLAKYPEYQEKCREEIQEVMKGRELEELDWDDLT 384

  Fly   353 KMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKV---GDRINIPISGLHLDDRY 414
            ::.:..|.|.||||::.......|.|::|        .||.|.:|   |....:.|.|.|.:...
Mouse   385 QLPFTTMCIKESLRQFPPVTLISRRCTED--------IKLPDGRVIPKGIICLVSIYGTHHNPIV 441

  Fly   415 FPEPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHY--------K 471
            :|:.:.::|.||..:......|..::||..|||||||..:|:.:::.::...||.:        |
Mouse   442 WPDSKVYNPYRFDPDTPQQRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRLSVDRTHK 506

  Fly   472 IEASPRTIKDLWGSASGFNFTPRSGFWMHLVP 503
            :...|..|           ....:|.|:::.|
Mouse   507 VRRKPELI-----------LRTENGLWLNVEP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 105/498 (21%)
Cyp4f39NP_796281.1 p450 60..515 CDD:365848 105/506 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.