DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001028858.2 Gene:Cyp4f18 / 290623 RGDID:1305261 Length:524 Species:Rattus norvegicus


Alignment Length:458 Identity:106/458 - (23%)
Similarity:180/458 - (39%) Gaps:70/458 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKHMRNTLTPVFTAAKMR 144
            |:|.:..|..||.|.:......|..:.|.........|.|.:....:|...|:.|||.|....::
  Rat    97 PVIRIFHPAFIKPVILAPASVAPKDRVFYRFLKPWLGDGLLLSTGDKWSRHRHMLTPAFHFNILK 161

  Fly   145 NMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTAFGLKVNSYDNPKNEF 209
            ....:.|:|    ...:.:..:.|..:....:||....:.::.|.:....|....|..:.|....
  Rat   162 PYVKIFNDS----TNIMHAKWQRLASQGSARLDMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYI 222

  Fly   210 YEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAMQYREK----HNIT 270
            ..|              ..||.||.:....|.|      .||.|..|..:.|::|:.    |:.|
  Rat   223 TAI--------------LELSALVARRHQSLLL------YVDLFYHLTRDGMRFRKACRLVHDFT 267

  Fly   271 RP---------------------------DMIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAFEN 308
            ..                           |.|.:|:.:|:|..:..:|::|.|:...|.|...:.
  Rat   268 DAVIRERRRTLPDQGGDDALKAKAKAKTLDFIDVLLLSKDEHGEALSDEDIRAEADTFMFGGHDT 332

  Fly   309 NSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAA 373
            .::.:....|.|..:|:.|||..:|:.|..:......:.:|.:.::.::.|.|.||||....|.|
  Rat   333 TASGLSWILYNLAKHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPATA 397

  Fly   374 TDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYT 438
            ..|.|::|..|  .||..:   ..|....|.|.|.|.:...:|:|..::|.||..:......|..
  Rat   398 ISRCCTQDIML--PDGRVI---PKGVICRISIFGTHHNPAVWPDPEVYNPFRFDADNGEGRSPLA 457

  Fly   439 YLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI---EASPRTIKDLWGSASGFNFTPRSGFWMH 500
            ::||..|||||||..:|:.::|..|...||.:::   :..||...:|...|.|       |.|:.
  Rat   458 FIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRVLPDDKEPRRKPELILRAEG-------GLWLR 515

  Fly   501 LVP 503
            :.|
  Rat   516 VEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 99/431 (23%)
Cyp4f18NP_001028858.2 CYP4F 74..515 CDD:410772 105/453 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.