DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP4V2

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_997235.3 Gene:CYP4V2 / 285440 HGNCID:23198 Length:525 Species:Homo sapiens


Alignment Length:516 Identity:119/516 - (23%)
Similarity:213/516 - (41%) Gaps:98/516 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KPYPFVGNMAAAALQKSSFQRQLTEFYERTRQHKLVGFFNMRTPMITLNDPELIKKVCVKDFDHF 101
            :.||.||:..........|.:|:.|:.|..|...|:..:....||:.|.:.|             
Human    55 RAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAE------------- 106

  Fly   102 PNHQPFITSNDRLFNDMLSVMR--------------DQRWKHMRNTLTPVFTAAKMRNMFTLMNE 152
             |.:..:||:.::  |..|:.:              ..:|:..|..|||.|....:.:...:|||
Human   107 -NVEVILTSSKQI--DKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNE 168

  Fly   153 SFAECLQHLDSSSKTLPGRKGFEVDMKV-MCNKLSNDIIATTAFGLKVNSYDNPKNEF----YEI 212
            .....::.|:...    .::.|.....: :|   :.|||..||.|..:.:..|..:|:    |.:
Human   169 QANILVKKLEKHI----NQEAFNCFFYITLC---ALDIICETAMGKNIGAQSNDDSEYVRAVYRM 226

  Fly   213 GQS----------------LVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAM 261
            .:.                |:|..|.:..|           ||..|..|.::       ::.|..
Human   227 SEMIFRRIKMPWLWLDLWYLMFKEGWEHKK-----------SLQILHTFTNS-------VIAERA 273

  Fly   262 QYREKHNITRPD-------------MIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLI 313
            .....:...|.|             .:.||:...::..::.:.::|..:...|.|...:..:..|
Human   274 NEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAI 338

  Fly   314 CTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLC 378
            ..:.|.|..||:||:::..|: :.....:..|.|.:.::|:.|::.||.|:||.:.......|..
Human   339 NWSLYLLGSNPEVQKKVDHEL-DDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSV 402

  Fly   379 SKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLPFG 443
            |:|..:.   |.::  .|..:.:.||.: ||.|.||||.|.:|.|:||..|......||.|:||.
Human   403 SEDCEVA---GYRV--LKGTEAVIIPYA-LHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFS 461

  Fly   444 VGPRNCIGNRYALMQVKGMLFNLLLHYKIEASPRTIKDLWGSASGFNFTPRSGFWMHLVPR 504
            .|||||||.::|:|:.|.:|..:|.|:.||::.:  ::..|........|.:|.|:.|..|
Human   462 AGPRNCIGQKFAVMEEKTILSCILRHFWIESNQK--REELGLEGQLILRPSNGIWIKLKRR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 113/488 (23%)
CYP4V2NP_997235.3 p450 55..517 CDD:278495 117/511 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.