DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP4A22

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:521 Identity:121/521 - (23%)
Similarity:195/521 - (37%) Gaps:99/521 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALIEICLALVVIG--YLIYKWSTATFKTFEERKLYFEKPYPFVGNMAAAALQKSSFQRQLTEFYE 64
            :|:.:.|.|:...  ||..:|.....:.|         |.| ..:.....:|:....::|....|
Human    23 SLLILLLLLIKAAQLYLHRQWLLKALQQF---------PCP-PSHWLFGHIQEFQHDQELQRIQE 77

  Fly    65 RTRQHKLVGFFNMRTP--------MITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSV 121
            |.:.      |....|        .:.|.||:.:|.:..:..........|:.  .|:...:| :
Human    78 RVKT------FPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSYKFLA--PRIGYGLL-L 133

  Fly   122 MRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLS 186
            :..|.|...|..|||.|....::....||.:|....   ||...:.|......||...|  :.::
Human   134 LNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVM---LDKWEELLGQDSPLEVFQHV--SLMT 193

  Fly   187 NDIIATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLKL------TIF 245
            .|.|..:||     |:..          |:...|..|.:...:|.|...:|..::.      ||:
Human   194 LDTIMKSAF-----SHQG----------SIQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIY 243

  Fly   246 DSAKVDYFARLVVEAMQYREKH-------------------NITRP---DMIQLLMEAKNESEDK 288
            .....   .|....|.|...:|                   .|.|.   |.:.:|:.||.|:...
Human   244 SLTSA---GRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSI 305

  Fly   289 WTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKAL--NGAPLTYDAV 351
            .:|.::.|:...|.|...:..::.|....|.|..:|..|||..|||    ..|  :||.:|::.:
Human   306 LSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEI----HGLLGDGASITWNHL 366

  Fly   352 QKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFP 416
            .:|.|..|.|.|:||.:.......|..|...|.  .||..|   ..|..:.:.|.|||.:.:.:|
Human   367 DQMPYTTMCIKEALRLYPPVPGIGRELSTPVTF--PDGRSL---PKGIMVLLSIYGLHHNPKVWP 426

  Fly   417 EPRKFDPDRF---SEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEASPRT 478
            ....|||.||   |.:..     :.:|||..|.|||||.::|:.|:|......||.:::...|..
Human   427 NLEVFDPSRFAPGSAQHS-----HAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTR 486

  Fly   479 I 479
            |
Human   487 I 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 113/481 (23%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 114/483 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.