DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4a12a

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_803125.2 Gene:Cyp4a12a / 277753 MGIID:88612 Length:508 Species:Mus musculus


Alignment Length:382 Identity:98/382 - (25%)
Similarity:161/382 - (42%) Gaps:46/382 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECL---QHLDSSSKTLPGRKGFEVDMKV 180
            |.::..|.|...|..|||.|....::....:|.:|....|   :.:.....||      |:...:
Mouse   129 LLMLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVRVMLDKWEQIVGQDSTL------EIFRHI 187

  Fly   181 MCNKLSNDIIATTAFG--------LKVNSYDNPKNEFYEIGQSLVFSRGLQFFK-----FMLSTL 232
            ....|  |.|...||.        .|..||.....:.    ..|||||....|.     :.:|:.
Mouse   188 TLMTL--DTIMKCAFSHEGSVQLDRKYKSYIQAVEDL----NDLVFSRVRNIFHQNDIIYRVSSN 246

  Fly   233 VPKLFSLLKLTIFDSAKVDYFARLVVEAMQYREK-HNITRPDMIQLLMEAKNESEDKWTDDEIVA 296
            ..|..|..||....:.:|....|:.::..:..|| ....|.|.:.:|:.|:.|:....:|.::.|
Mouse   247 GCKANSACKLAHDHTDQVIKSRRIQLQDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRA 311

  Fly   297 QCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKAL--NGAPLTYDAVQKMTYMDM 359
            :...|.|...:..::.|....|.|..||:.|:|..:||    ::|  :|..:|::.:.||.|..|
Mouse   312 EVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEI----QSLLGDGTSITWNDLDKMPYTTM 372

  Fly   360 VISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPD 424
            .|.|:||.:....:..|..|...|.  .||..|   ..|..:.:...|||.:...:|.|..|||.
Mouse   373 CIKEALRIYPPVPSVSRELSSPVTF--PDGRSL---PKGIHVMLSFYGLHHNPTVWPNPEVFDPS 432

  Fly   425 RFS--EERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEASPRTI 479
            ||:  ..|..    :::|||..|.|||||.::|:.::|..:...||.:::...|..:
Mouse   433 RFAPGSSRHS----HSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRV 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 98/379 (26%)
Cyp4a12aNP_803125.2 p450 52..502 CDD:278495 98/382 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.