DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4a8

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:XP_038965258.1 Gene:Cyp4a8 / 266674 RGDID:628846 Length:510 Species:Rattus norvegicus


Alignment Length:529 Identity:128/529 - (24%)
Similarity:211/529 - (39%) Gaps:107/529 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALIEICLALVVIGYLIYKWSTATFKTFEERKLYFEKPYP------FVGNMAAAALQKSSFQRQL 59
            :..::|...|.|: .|::|  ||.|.......|...:.:|      |.|: ..:.|....||..|
  Rat    16 LGFLQIATVLTVL-LLLFK--TAQFYLHRRWLLRATQQFPSPPSHWFFGH-KLSFLVDQEFQDIL 76

  Fly    60 TEFYERTRQHKLVGFFNMRTPM--------ITLNDPELIKKVCVKDFDHFPNHQ-----PFITSN 111
            |.          |..|....|.        |.:.||:.:|.:..:. |...:|.     |:|...
  Rat    77 TR----------VKNFPSACPQWLWGSNVRIQVYDPDYMKLILGRS-DPKSHHSYRFLAPWIGYG 130

  Fly   112 DRLFNDMLSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLM----------------NESFAECLQH 160
                   |.::..|.|...|..|||.|....::....:|                .:|..|..||
  Rat   131 -------LLLLNGQTWFQHRRMLTPAFHYDTLKPYVGIMADSVRIMLDKWEQIVGQDSTLEIFQH 188

  Fly   161 -----LDSSSKTLPGRKG-FEVDMKVMCN-KLSNDIIATTAFGLKVNSYDNPKNEFYEIGQSLVF 218
                 ||:..|....::| .::|.|.... |...|:...:.|.:        :|.|::  ..:::
  Rat   189 ITLMTLDTIMKCAFSQEGSVQLDRKYKSYIKAVEDLNNLSFFRI--------RNIFHQ--NDIIY 243

  Fly   219 SRGLQFFKFMLSTLVPKLFSLLKLT------IFDSAKVDYFARLVVEAMQYREKHNITRPDMIQL 277
            |         ||:...|..|..:|.      :..|.|    |:|..|....:.|.. .|.|.:.:
  Rat   244 S---------LSSNGRKARSAWQLAHEHTDQVIKSRK----AQLQDEEELQKVKQK-RRLDFLDI 294

  Fly   278 LMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKAL- 341
            |:.|:.|:....:|.::.|:...|.|...:..::.|....|.|..||:.|:...:||    ::| 
  Rat   295 LLFARIENGSSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQGCRKEI----QSLL 355

  Fly   342 -NGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPI 405
             :||.:|:|.:.||.|..|.|.|:||.:....|..|:.|...|.  .||..|   ..|..:.:..
  Rat   356 GDGASITWDDLDKMPYTTMCIKEALRIYPPVTAVSRMLSTPVTF--PDGRSL---PKGITVMLSF 415

  Fly   406 SGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHY 470
            .|||.:...:|.|..|||.||:.|  .....:::|||..|.|||||.::|:.::|..:...||.:
  Rat   416 YGLHHNPTVWPNPEVFDPYRFAPE--SSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRF 478

  Fly   471 KIEASPRTI 479
            ::...|..|
  Rat   479 ELLPDPTRI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 118/490 (24%)
Cyp4a8XP_038965258.1 CYP4B-like 72..505 CDD:410771 115/469 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.