DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP4Z1

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_835235.1 Gene:CYP4Z1 / 199974 HGNCID:20583 Length:505 Species:Homo sapiens


Alignment Length:533 Identity:132/533 - (24%)
Similarity:217/533 - (40%) Gaps:133/533 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALIEICLALVVIGYL-IY---KWSTATFKTFEERKLYFEKPYP----FVGNMAAAALQKSSFQR 57
            :.||.:|::|::...: :|   :|.......|         |.|    |.|:             
Human    15 LLLILLCMSLLLFQVIRLYQRRRWMIRALHLF---------PAPPAHWFYGH------------- 57

  Fly    58 QLTEFY---ERTRQHKL-----------VGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFI 108
              .|||   |....|||           ||.|.|   ..:::||: ..|:.:|..|      |..
Human    58 --KEFYPVKEFEVYHKLMEKYPCAVPLWVGPFTM---FFSVHDPD-YAKILLKRQD------PKS 110

  Fly   109 TSNDRLFNDM----LSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESF--------------- 154
            ..:.::....    |..:...:||..|..:.|.|..:.::...|:|:||.               
Human   111 AVSHKILESWVGRGLVTLDGSKWKKHRQIVKPGFNISILKIFITMMSESVRMMLNKWEEHIAQNS 175

  Fly   155 -AECLQH-----LDSSSKTLPGRKG-FEVD------MKVMCN--KLSNDIIATTAFGLKVNSYDN 204
             .|..||     |||..|.....:| .::|      :|.:.|  |:||.         ::|::.:
Human   176 RLELFQHVSLMTLDSIMKCAFSHQGSIQLDSTLDSYLKAVFNLSKISNQ---------RMNNFLH 231

  Fly   205 PKNEFYEIGQSLVF---SRGLQFFKF--MLSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAMQYR 264
            ..:        |||   |:|..|.||  .|.....|:....|.::.|..|.|        ..|.|
Human   232 HND--------LVFKFSSQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQD--------TTQKR 280

  Fly   265 EKHNITRPDMIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQER 329
                  |.|.:.:|:.||:|:...:::.::.|:...|.||..:..|:.|....|.|...|:.|:|
Human   281 ------RWDFLDILLSAKSENTKDFSEADLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQR 339

  Fly   330 LYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFD 394
            ..:||.|...  :|:.:|::.:.:|.|..|.|.|.||.:.......||..|  .:|..||..|  
Human   340 CRDEIRELLG--DGSSITWEHLSQMPYTTMCIKECLRLYAPVVNISRLLDK--PITFPDGRSL-- 398

  Fly   395 FKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQV 459
             ..|..:.|.|..||.:..::.:|:.|:|.|||.|....:.||.::||..|.|||||..:|:::.
Human   399 -PAGITVFINIWALHHNPYFWEDPQVFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIEC 462

  Fly   460 KGMLFNLLLHYKI 472
            |..:...||.:|:
Human   463 KVAVALTLLRFKL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 125/493 (25%)
CYP4Z1NP_835235.1 p450 47..500 CDD:278495 125/492 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.