DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and cyp-29A2

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_505847.1 Gene:cyp-29A2 / 179550 WormBaseID:WBGene00011830 Length:503 Species:Caenorhabditis elegans


Alignment Length:414 Identity:107/414 - (25%)
Similarity:181/414 - (43%) Gaps:75/414 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 QRWKHMRNTLTPVFTAAKMRNMFTLMNES---FAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLS 186
            :|||..|..|||.|..||:...|.:.|..   ..:.|....:|.:|        ||:.....:.:
 Worm   130 ERWKSHRKMLTPAFHFAKLGGYFEVFNNESKILIDLLSDFSASGET--------VDIFPYVKRCA 186

  Fly   187 NDIIATTAFGLKVNSYDNPKNEFYE-------IGQSLVFSRGL--QF----------FKFMLSTL 232
            .|||:.||.|:|:::..|..:::.:       ||..:.|:..|  ||          :...||||
 Worm   187 LDIISETAMGIKIDAQINHDHKYVQAVEGYNKIGVLVSFNPHLKNQFIFWATGYKAQYDDYLSTL 251

  Fly   233 VPKLFSLLK--LTIFDSAKVDYFARLVVEAMQYREKHNITR-PDMIQLLMEAKNESEDKWTDDEI 294
            ......::|  ....||.:|              ||....| .:.:.|::..  |..::.|.::|
 Worm   252 KSMTEKVIKERRAAHDSGEV--------------EKETSKRMMNFLDLMLSM--EESNQLTSEDI 300

  Fly   295 VAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDM 359
            ..:...|.||..:..::......:.|.:||:|||::|:|::|.........:|.:.|..:.|:|:
 Worm   301 RQEVDTFMFAGHDTTTSSTSWACWNLAHNPNVQEKVYKEMIEVFGDDPNTDITLENVNNLNYLDI 365

  Fly   360 VISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPD 424
            |:.||.|......|..|..:.|..:   ||   :....|..:.|....||.:...|..|.:|:||
 Worm   366 VLKESKRIIAPVPALQRKLTNDLEI---DG---YIVPAGGNVTISPMVLHSNHHVFKNPTEFNPD 424

  Fly   425 RFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEASPRTIKDLWGSASGF 489
            ||..:......||.::||..|||||||.::|.:..|.|:.:::.::|||.   |:|        :
 Worm   425 RFLPDEVSKRHPYDFMPFLAGPRNCIGQKFAQLNEKVMISHIVRNFKIEP---TLK--------Y 478

  Fly   490 NFT---------PRSGFWMHLVPR 504
            |.|         |.:|..:.|:.|
 Worm   479 NDTKPCLEVVTKPSNGIPVRLIRR 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 99/377 (26%)
cyp-29A2NP_505847.1 p450 37..495 CDD:278495 104/405 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.