DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and cest-32

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:255 Identity:54/255 - (21%)
Similarity:86/255 - (33%) Gaps:100/255 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LSTLVPKLFSLLK---------LTIFDSAKVDY------FARLVVE--------AMQYREKHNIT 270
            ||...|||.::..         ||:|.|.:.|.      |...|||        .|::..| ||.
 Worm   315 LSREAPKLDAMATVDEYEGLGFLTMFQSRRNDMDIIKSSFGSDVVENAVDVQKRIMEFYMK-NID 378

  Fly   271 RPD-------MIQLLMEAKNESEDKW----------TDDEIVAQCFIFFFAAFENNSNLICTTTY 318
            :.|       :|||:       .|.|          |..:..:..::..|..:...||       
 Worm   379 KNDDKAVEKRLIQLI-------SDSWFNIGALETVKTSTKYGSNAYLGSFDYYNMGSN------- 429

  Fly   319 ELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKDYT 383
                :|      |......|.|.:|:.|.|           ::.|.:.|::       ...:::.
 Worm   430 ----DP------YATWFPFKAANHGSELKY-----------MLGEGMGKFS-------PIEEEFK 466

  Fly   384 LTDDDGTKLFDF-KVGDRINIP--ISGLHLDDRYFPE----------PRKFDPDRFSEER 430
            :.|..||...:| |.|:    |  |:|..|..:|.||          |:....|.|.:.|
 Worm   467 VIDMMGTLTANFVKYGN----PNGINGPELWKKYTPEKPYSYFKIDYPKSEMRDNFQDGR 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 54/255 (21%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 51/247 (21%)
Aes <104..>227 CDD:223730
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.