DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP7A1

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_000771.2 Gene:CYP7A1 / 1581 HGNCID:2651 Length:504 Species:Homo sapiens


Alignment Length:513 Identity:115/513 - (22%)
Similarity:205/513 - (39%) Gaps:94/513 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALIEICLALVVIGYLIYKWSTATFKTFEERKLYFEKP-----YPFVGNMAAAALQKSSFQRQLT 60
            :|:...|...:::|.              .|:...|.|     .|::|    .|||..:...:..
Human    10 IAIAACCCLWLILGI--------------RRRQTGEPPLENGLIPYLG----CALQFGANPLEFL 56

  Fly    61 EFYERTRQH----KLVGFFNMRTPMITLNDPELIKKVC-VKDFDHFPNHQPFITSNDRLFNDMLS 120
            ...:|...|    ||:|.:   ...|| |.....|.:| .|.||....|  |.||.....:..:.
Human    57 RANQRKHGHVFTCKLMGKY---VHFIT-NPLSYHKVLCHGKYFDWKKFH--FATSAKAFGHRSID 115

  Fly   121 VMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHL-----DSSSKT----LPGRKGFEV 176
            .|.....:::.:|    |......:....:.||..|.||.:     .|:|||    ..|...|  
Human   116 PMDGNTTENINDT----FIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSF-- 174

  Fly   177 DMKVMCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLK 241
                 |.::..:....|.||..:...|..|....         ..|..|| ....:.|.|.:.|.
Human   175 -----CYRVMFEAGYLTIFGRDLTRRDTQKAHIL---------NNLDNFK-QFDKVFPALVAGLP 224

  Fly   242 LTIFDSAKVDYFAR-LVVEAMQYREKHNITRPDMIQLLMEAK---NESEDKWTDDEIVAQCFIFF 302
            :.:|.:|   :.|| .:.|::::   .|:.:.:.|..|:..:   |::...:.|.|......:..
Human   225 IHMFRTA---HNAREKLAESLRH---ENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVL 283

  Fly   303 FAAFENNSNLICTTTYELLYNPDVQERLYEEIVET------KKALNGAP--LTYDAVQKMTYMDM 359
            :|:..|.......:.::::.||:..:...||:..|      |.:|.|.|  |:...:..:..:|.
Human   284 WASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDS 348

  Fly   360 VISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPD 424
            :|.|||| .:.|:...|...:|:||..:||:  ::.:..|.|.:....:|||...:|:|..|..|
Human   349 IIKESLR-LSSASLNIRTAKEDFTLHLEDGS--YNIRKDDIIALYPQLMHLDPEIYPDPLTFKYD 410

  Fly   425 RFSEER---------KGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIE 473
            |:.:|.         .|..:.|.|:|||.|...|.|..:|:.::|..|..:|.::::|
Human   411 RYLDENGKTKTTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELE 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 110/477 (23%)
CYP7A1NP_000771.2 p450 32..497 CDD:365848 110/477 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5364
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.