DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP4A11

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:465 Identity:113/465 - (24%)
Similarity:185/465 - (39%) Gaps:83/465 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RQLTEFYERTRQHKLVGFFNMRTP--------MITLNDPELIKKVC----VKDFDHFPNHQPFIT 109
            ::|.:..|..|..|.|..|....|        .:.|.||:.:|.:.    .|....:....|:|.
Human    64 QELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIG 128

  Fly   110 SNDRLFNDMLSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGF 174
            ..       |.::..|.|...|..|||.|....::....||.:|....   ||...:.|......
Human   129 YG-------LLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVM---LDKWEELLGQDSPL 183

  Fly   175 EVDMKVMCNKLSNDIIATTAF----GLKVNSYDNPKNEFYEIG--QSLVFSRGLQFFK-----FM 228
            ||...|  :.::.|.|...||    .::|:.  |.::....|.  .:|||||....|.     :.
Human   184 EVFQHV--SLMTLDTIMKCAFSHQGSIQVDR--NSQSYIQAISDLNNLVFSRVRNAFHQNDTIYS 244

  Fly   229 LSTL--------------VPKLFSLLKLTIFDSAKVDYFARLVVEAMQYREKHNITRPDMIQLLM 279
            |::.              ..::..|.|..:....:::...         |::|    .|.:.:|:
Human   245 LTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIK---------RKRH----LDFLDILL 296

  Fly   280 EAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKAL--N 342
            .||.|:....:|.::.|:...|.|...:..::.|....|.|..:|..|||..|||    .:|  :
Human   297 LAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEI----HSLLGD 357

  Fly   343 GAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISG 407
            ||.:|::.:.:|.|..|.|.|:||.:.......|..|...|.  .||..|   ..|..:.:.|.|
Human   358 GASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTF--PDGRSL---PKGIMVLLSIYG 417

  Fly   408 LHLDDRYFPEPRKFDPDRF---SEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLH 469
            ||.:.:.:|.|..|||.||   |.:..     :.:|||..|.|||||.::|:.::|......||.
Human   418 LHHNPKVWPNPEVFDPFRFAPGSAQHS-----HAFLPFSGGSRNCIGKQFAMNELKVATALTLLR 477

  Fly   470 YKIEASPRTI 479
            :::...|..|
Human   478 FELLPDPTRI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 112/462 (24%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 113/465 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.