DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus


Alignment Length:428 Identity:104/428 - (24%)
Similarity:177/428 - (41%) Gaps:49/428 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KLVGFFNMRTP-----MITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKH 129
            :.:.|.|:..|     :.:..||   |...|.||        |:    :.....|.|:...:|..
Mouse    87 QFIVFLNIYEPDYAKAVYSRGDP---KAAYVYDF--------FL----QWIGKGLLVLEGPKWFQ 136

  Fly   130 MRNTLTPVFTAAKMRNMFTLMNESFAECLQ-HLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATT 193
            .|..|||.|....::....:    |||..: .||...|.....|.|::...|  ..::.|.:...
Mouse   137 HRKLLTPGFHYDVLKPYVAI----FAESTRVMLDKWEKKASENKSFDIFCDV--GHMALDTLMKC 195

  Fly   194 AFGLKVNSYDNPKNEFY--EIGQSLVFSRGLQFFKF---MLSTLVPKLFSLLKLTIFDSAKVDYF 253
            .||...:...:..|.:|  ....:|:..:.:..|::   .:..|.|.....|:.........|:.
Mouse   196 TFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRRFLRACQIAHDHTDHV 260

  Fly   254 ARLVVEAMQ-------YREKHNITRPDMIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSN 311
            .|....|:|       .:|:.::   |.:.:|:.|::||..|.:|.::.|:...|.|...:..::
Mouse   261 IRQRKAALQDEKEQKKLQERRHL---DFLDILLGARDESGIKLSDADLRAEVDTFMFEGHDTTTS 322

  Fly   312 LICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDR 376
            .|....|.:...|..|:|..||:.|.....:.  ..:|.:.:|||:.|.:.|..|.:.......|
Mouse   323 GISWFLYCMALYPMHQQRCREEVREILGDRDS--FQWDDLAQMTYLTMCMKECFRLYPPVPQVYR 385

  Fly   377 LCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLP 441
            ..||..|..  ||..|   ..|..|::.|..||.:...:|:|..|||.|||.|......|:.::|
Mouse   386 QLSKPVTFV--DGRSL---PAGSLISLHIYALHRNSAVWPDPEVFDPLRFSPENMTGRHPFAFMP 445

  Fly   442 FGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEASPRTI 479
            |..|||||||.::|:.::|.:....||.::....|..|
Mouse   446 FSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSPDPSKI 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 103/425 (24%)
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 104/428 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.