DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4a14

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_031848.1 Gene:Cyp4a14 / 13119 MGIID:1096550 Length:507 Species:Mus musculus


Alignment Length:403 Identity:89/403 - (22%)
Similarity:170/403 - (42%) Gaps:89/403 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 HFPNHQPFITSNDRLFNDMLSVMRDQRWKHMRNTLTP--VFTAAKMRNMFTLMNESFA-ECLQHL 161
            |:...:|::    ::..|.:::|.| :|:.:.....|  :|....:..:.|:|..:|: :....|
Mouse   148 HYDILKPYV----KIMADSVNIMLD-KWEKLDGQDHPLEIFHCVSLMTLDTVMKCAFSYQGSVQL 207

  Fly   162 DSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQFFK 226
            |.:||              :..|...|:...|.|.|        :|.||:  .:::::       
Mouse   208 DENSK--------------LYTKAVEDLNNLTFFRL--------RNAFYK--YNIIYN------- 241

  Fly   227 FMLSTLVPKLFSLLKLTIFDSAKVDYFARLVV-------------------EAMQYREKHNITRP 272
                             :....::.:.|..:.                   |..:.|:|.::   
Mouse   242 -----------------MSSDGRLSHHACQIAHEHTDGVIKMRKSQLQNEEELQKARKKRHL--- 286

  Fly   273 DMIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVET 337
            |.:.:|:.|:.|..:..:|:::.|:...|.|...:..::.|....|.|..:|:.|:|..||:   
Mouse   287 DFLDILLFARMEDRNSLSDEDLRAEVDTFMFEGHDTTASGISWIFYALATHPEHQQRCREEV--- 348

  Fly   338 KKAL-NGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRI 401
            :..| :|..:|:|.:.:|.|..|.|.|:||.:....:..|..|...|.  .||..:   ..|...
Mouse   349 QSILGDGTSVTWDHLGQMPYTTMCIKEALRLYPPVISVSRELSSPVTF--PDGRSI---PKGITA 408

  Fly   402 NIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNL 466
            .|.|.|||.:.|::|.|:.|||.||:.:....  .:.||||..|.|||||.::|:.::|..:...
Mouse   409 TISIYGLHHNPRFWPNPKVFDPSRFAPDSSHH--SHAYLPFSGGSRNCIGKQFAMNELKVAVALT 471

  Fly   467 LLHYKIEASPRTI 479
            ||.:::...|..|
Mouse   472 LLRFELLPDPTRI 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 88/400 (22%)
Cyp4a14NP_031848.1 p450 52..501 CDD:278495 89/403 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.