DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4a12b

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_758510.2 Gene:Cyp4a12b / 13118 MGIID:3611747 Length:508 Species:Mus musculus


Alignment Length:401 Identity:94/401 - (23%)
Similarity:158/401 - (39%) Gaps:84/401 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLM----------------NESFAECLQH-----LD 162
            |.::..|.|...|..|||.|....::....:|                .:|..|..||     ||
Mouse   129 LLLLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVHVMLDKWEQIVGQDSTLEIFQHITLMTLD 193

  Fly   163 SSSKTLPGRKG-FEVDMKV-----MCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQS------ 215
            :..|.....:| .::|.|.     ....|:|      .|.|:|.:..:..:..|.:..:      
Mouse   194 TIMKCAFSHEGSVQLDRKYKSYIQAVEDLNN------LFFLRVRNIFHQNDIIYRVSSNGCLANS 252

  Fly   216 ---LVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAMQYREKHNITRPDMIQL 277
               |......|..|...|.|..:                       |.::..:|..  |.|.:.:
Mouse   253 ACQLAHDHTDQVIKSRRSQLQDE-----------------------EELEKLKKKR--RLDFLDI 292

  Fly   278 LMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKAL- 341
            |:.|:.|:....:|.::.|:...|.|...:..::.|....|.|..||:.|:|..:||    ::| 
Mouse   293 LLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEI----QSLL 353

  Fly   342 -NGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPI 405
             :||.:|::.:.||.|..|.|.|:||.:....:..|..|...|.  .||..|   ..|..:.:..
Mouse   354 GDGASITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTF--PDGRSL---PKGIHVMLSF 413

  Fly   406 SGLHLDDRYFPEPRKFDPDRFS--EERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLL 468
            .|||.:...:|.|..|||.||:  ..|..    :::|||..|.|||||.::|:.::|..:...||
Mouse   414 YGLHHNPTVWPNPEVFDPSRFAPGSSRHS----HSFLPFSGGARNCIGKQFAMNELKVAVALTLL 474

  Fly   469 HYKIEASPRTI 479
            .:::...|..:
Mouse   475 RFELLPDPTRV 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 94/398 (24%)
Cyp4a12bNP_758510.2 CYP4B-like 70..503 CDD:410771 94/401 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.