DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and CYP4F8

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_009184.1 Gene:CYP4F8 / 11283 HGNCID:2648 Length:520 Species:Homo sapiens


Alignment Length:540 Identity:126/540 - (23%)
Similarity:221/540 - (40%) Gaps:85/540 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALVVIG--YL---IYKWSTATFKTFEERKLYFEKPYP-----FVGNMAAAALQKSSFQRQLTEF 62
            |.|:|:|  :|   |..|:.|.:......:.:   |.|     |:|::......:... |.||:.
Human    20 LLLLVVGASWLLARILAWTYAFYHNGRRLRCF---PQPRKQNWFLGHLGLVTPTEEGL-RVLTQL 80

  Fly    63 YERTRQHKLVGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLF--------NDML 119
            . .|.....|.:....||:|.|..|::::.|.        |....||..|.:|        .|.|
Human    81 V-ATYPQGFVRWLGPITPIINLCHPDIVRSVI--------NTSDAITDKDIVFYKTLKPWLGDGL 136

  Fly   120 SVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNK 184
            .:....:|:|.|..|||.|....::....:.::|  ..:.|.......:.|....:|...:  :.
Human   137 LLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKS--ANIMHAKWQRLAMEGSTCLDVFEHI--SL 197

  Fly   185 LSNDIIATTAFGLKVNSYDNPKNEFYEIGQ--SLVFSRGLQFFKF--MLSTLVP--KLFSLLKLT 243
            ::.|.:....|....|..:.|......|.:  :||..|..|||::  .|..|.|  :.|......
Human   198 MTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRL 262

  Fly   244 IFD--------------SAKVDYFARLVVEAMQYREKHNITRPDMIQLLMEAKNESEDKWTDDEI 294
            :.|              |..||.|       :|.:.|....  |.|.:|:.:::::..:.:|::|
Human   263 VHDFTDAVIQERRRTLTSQGVDDF-------LQAKAKSKTL--DFIDVLLLSEDKNGKELSDEDI 318

  Fly   295 VAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDM 359
            .|:...|.|...:..::.:....|.|..:|:.|||..:|:.|..|......:.:|.:.::.::.|
Human   319 RAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTM 383

  Fly   360 VISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKV---GDRINIPISGLHLDDRYFPEPRKF 421
            .:.||||.........|.|::|..|.|.        :|   |:..||.|..:|.:...:|:|..:
Human   384 CLKESLRLHPPIPTFARGCTQDVVLPDS--------RVIPKGNVCNINIFAIHHNPSVWPDPEVY 440

  Fly   422 DPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI---EASPRTIKDLW 483
            ||.||..|......|..::||..|||||||.::|:.::|.:|...||.::|   ...||...::.
Human   441 DPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPRRTPEIV 505

  Fly   484 GSASGFNFTPRSGFWMHLVP 503
            ..|       ..|.|:.:.|
Human   506 LRA-------EDGLWLRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 113/479 (24%)
CYP4F8NP_009184.1 p450 52..504 CDD:306555 114/482 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.