DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b2 and Cyp4a32

DIOPT Version :9

Sequence 1:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001093651.1 Gene:Cyp4a32 / 100040843 MGIID:3717148 Length:509 Species:Mus musculus


Alignment Length:468 Identity:110/468 - (23%)
Similarity:185/468 - (39%) Gaps:106/468 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDM----LSVMRDQRWKHMRNTLTPVF---- 138
            :|:.||:.:|.:..:.       .|......||....    |.::..|.|...|..|||.|    
Mouse    96 LTVYDPDYMKVILGRS-------DPKANGIYRLLAPWIGYGLLLLNGQPWFQHRRMLTPAFHYDI 153

  Fly   139 ---TAAKMRNMFTLM---------NESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIA 191
               ....|.:...||         .:|..|..||:  |..||                   |.:.
Mouse   154 LKPYVKNMADSIRLMLDKWERLAGQDSSIEIFQHI--SLMTL-------------------DTVM 197

  Fly   192 TTAFGLK--VNSYDNPKNEFYEIG--QSLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDY 252
            ..||..|  |....|.|.....||  .:|..||....|.             ...||:   ::..
Mouse   198 KCAFSHKGSVQVDGNYKTYLQAIGDLNNLFHSRVRNIFH-------------QNDTIY---RLSS 246

  Fly   253 FARLVVEAMQYREKH-------------------NI---TRPDMIQLLMEAKNESEDKWTDDEIV 295
            ..||..:|.|....|                   ||   .|.|.:.:|:.|:.|:.|..:|.::.
Mouse   247 NGRLAKQACQLAHDHTDGVIKMRKDQLQDEGELENIKKKRRLDFLDILLFARMENGDSMSDKDLR 311

  Fly   296 AQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKAL--NGAPLTYDAVQKMTYMD 358
            |:...|.|...:..::.:....|.|..:|:.|:|..||:    ::|  :|:.:|:|.:.::.|..
Mouse   312 AEVDTFMFEGHDTTASGVSWIFYALATHPEHQQRCREEV----QSLLGDGSSITWDHLDQIPYTT 372

  Fly   359 MVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDP 423
            |.|.|:||.:.......|..|.  ::|..||..|   ..|.::.:.|.|||.:.:.:|.|..|||
Mouse   373 MCIKEALRLYPPVPGIVRELST--SVTFPDGRSL---PKGVQVTLSIYGLHHNPKVWPNPEVFDP 432

  Fly   424 DRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEASPRTIKDLWGSASG 488
            .||:.:  .....:::|||..|.|||||.::|:.::|.::...|||:::...|..:.:   ..:.
Mouse   433 SRFAPD--SPRHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLHFELLPDPTRVPE---PLAR 492

  Fly   489 FNFTPRSGFWMHL 501
            .....::|.::||
Mouse   493 IVLKSKNGIYLHL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 107/443 (24%)
Cyp4a32NP_001093651.1 p450 52..503 CDD:278495 108/464 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.