DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP721A1

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_177649.1 Gene:CYP721A1 / 843850 AraportID:AT1G75130 Length:505 Species:Arabidopsis thaliana


Alignment Length:480 Identity:115/480 - (23%)
Similarity:201/480 - (41%) Gaps:65/480 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TG-TFKAFEGRN-----LYFE---KPYPFLGNMAASALQKASFQKQISEFYNRTRHHKLVGLFNL 77
            || :::.|.|.:     |..|   ||.|...|......:.|....:.|..|.:|    .:..|..
plant    39 TGPSYRIFSGNSGEVSRLTAEAKSKPIPSGRNPHEFVHRVAPHYHEWSRVYGKT----FLYWFGS 99

  Fly    78 RTPMIQINDPQLIKKICVK--DFDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPVFTS 140
            : |::..:||:||::....  .||.. .|..|   ::.|....|..:|...|...|.:....||.
plant   100 K-PVVATSDPRLIREALTTGGSFDRI-GHNPL---SKLLYAQGLPGLRGDQWAFHRRIAKQAFTM 159

  Fly   141 AKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKVNSFDDP 205
            .|::.....|..|....:|   ..:.:..|....||::....:.||.::::.||||   ||.::.
plant   160 EKLKRWVPQMVTSTMMLME---KWEDMRNGGEEIELEVHKEMHNLSAEMLSRTAFG---NSVEEG 218

  Fly   206 ENEFHTIGKTLAFSRGLPFLKFMMCLLAPKVFNFFKLTIFDSTN-----VEYFVRLVVDAMQYRE 265
            :..|....:.:..     |......:..|. |.||.    ..||     :|..:|:.:..:....
plant   219 KGIFELQERMMRL-----FYLVRWSVYIPG-FRFFP----SKTNREIWRIEKQIRVSILKLIENN 273

  Fly   266 KHNITRP-DMIQLLMEA---KKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDI 326
            |..:.:. .::|..|..   :...::....:|:..:|..|:|||.|..:||:......|..|.:.
plant   274 KTAVEKSGTLLQAFMSPYTNQNGQEEKLGIEEVTDECKTFYFAAKETTANLMTFVLVLLAMNQEW 338

  Fly   327 QERLYEEV----KETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDD 387
            |....|||    .:|     |.| |.|..|::..:.|:|:|:||.:..:...:|...|...|.| 
plant   339 QNIAREEVICVLGQT-----GLP-TLDILQDLKTLSMIINETLRLYPPAMTLNRDTLKRAKLGD- 396

  Fly   388 EGTKLFEFKAGDNINIPICGLHWD-ERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIG 451
                 .:..||..:.:.:..:|.| |.:....:.|:|.||.:.:|:..:   .:|||:|||:|:|
plant   397 -----LDIPAGTQLYLSVVAMHHDKETWGDDAEEFNPRRFEDPKKQSAL---LVPFGLGPRTCVG 453

  Fly   452 NRYAVMQAKGMLYNLMLNYKIEASP 476
            ...||.:||.:|..::..|....||
plant   454 QNLAVNEAKTVLATILKYYSFRLSP 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 109/456 (24%)
CYP721A1NP_177649.1 p450 26..495 CDD:386267 115/480 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.