DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP735A2

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_176882.1 Gene:CYP735A2 / 843031 AraportID:AT1G67110 Length:512 Species:Arabidopsis thaliana


Alignment Length:520 Identity:122/520 - (23%)
Similarity:210/520 - (40%) Gaps:94/520 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KAFEGRNLYFEKPYPFLGNMA-ASALQKASFQKQISEFYNRTRHHKLVG---------------- 73
            |..|.:.:...||....||:. .|.:...|.....|..     ||.:|.                
plant    38 KFMERQGITGPKPRLLTGNIIDISKMLSHSASNDCSSI-----HHNIVPRLLPHYVSWSKQYGKR 97

  Fly    74 --LFNLRTPMIQINDPQLIKKICVKDFDHFP-------NHQTLNIPNERLVNDMLNVMRDQHWRN 129
              ::|...|.:.:.:.::||::..|   |.|       ..|    ..:..:...|.:...:.|.:
plant    98 FIMWNGTEPRLCLTETEMIKELLTK---HNPVTGKSWLQQQ----GTKGFIGRGLLMANGEAWHH 155

  Fly   130 MRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTA 194
            .|.:..|.||..:::.....|.|......|.|:..    .||   |:::.....:|:.|:|:.|.
plant   156 QRHMAAPAFTRDRLKGYAKHMVECTKMMAERLRKE----VGE---EVEIGEEMRRLTADIISRTE 213

  Fly   195 FGLKVNSFDDPENEFH--TIGKTLAFSRGLPFLKFMMCLLAPKVFNFFKLTIFDSTNVEYFVRLV 257
            ||   :|.|..:..|.  |:.:.|. ::....|.|......|..:|....::  .|.||..:..:
plant   214 FG---SSCDKGKELFSLLTVLQRLC-AQATRHLCFPGSRFLPSKYNREIKSL--KTEVERLLMEI 272

  Fly   258 VDAMQYREKHNITR-----PDMIQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTA 317
            :|:.  ::...|.|     .|::.||:.....:|:|.....|:.:|..|||...|..|.|:..|.
plant   273 IDSR--KDSVEIGRSSSYGDDLLGLLLNQMDSNKNNLNVQMIMDECKTFFFTGHETTSLLLTWTL 335

  Fly   318 YELLRNLDIQERLYEEVKET--QEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAK 380
            ..|..|...|:.:.:||::.  |:   |.| :.:....:|.::.||:||||.:..:....|:..:
plant   336 MLLAHNPTWQDNVRDEVRQVCGQD---GVP-SVEQLSSLTSLNKVINESLRLYPPATLLPRMAFE 396

  Fly   381 DYTLTDDEGTKLFEFKAGDNINIPICGLH-----WDERFFPQPQRFDPERFSERRKKDLIPYTYL 440
            |..|.|      .....|.:|.||:..:|     |.|    ....|:||||:.|....  ...::
plant   397 DIKLGD------LIIPKGLSIWIPVLAIHHSNELWGE----DANEFNPERFTTRSFAS--SRHFM 449

  Fly   441 PFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPRTTRDMWESARGFNIIPTT---GFWMQLV 502
            ||..|||:|||..:|:|:||.:|..|:..:....|        |:.|...|:..|   .:.:|||
plant   450 PFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFAIS--------ENYRHAPIVVLTIKPKYGVQLV 506

  Fly   503  502
            plant   507  506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 113/480 (24%)
CYP735A2NP_176882.1 PLN02290 2..511 CDD:215164 122/520 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.