DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:260 Identity:56/260 - (21%)
Similarity:107/260 - (41%) Gaps:49/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ASFQKQISEFYNRT--RHHKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLV 115
            |.|..::..|.:.|  :|.|....:....|.:.:.||:.:::|..| .:.||..: :...|...:
plant    77 ADFLPRMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIMSK-HELFPKPK-IGSHNHVFL 139

  Fly   116 NDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKV 180
            :.:|| .....|...||:|.|.|....::::....|.|   |.|.|:..:.:|:.:...|||...
plant   140 SGLLN-HEGPKWSKHRSILNPAFRIDNLKSILPAFNSS---CKEMLEEWERLASAKGTMELDSWT 200

  Fly   181 LCNKLSNDVIATTAFGLKVNSFDDP------ENEFHTIGKTLAFSRGLPFLKFMMCLLAPKVFNF 239
            .|:.|:.:::|..:||   :|:.|.      :.|...:|.....:..:|..||:     |..|| 
plant   201 HCHDLTRNMLARASFG---DSYKDGIKIFEIQQEQIDLGLLAIRAVYIPGSKFL-----PTKFN- 256

  Fly   240 FKLTIFDSTNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKKE--SKDNWTD--DEIVAQCFI 300
                                 .:.||.....|. |.:.::|.|:|  .:...||  .:..::|::
plant   257 ---------------------RRLRETERDMRA-MFKAMIETKEEEIKRGRGTDKNSDCCSRCWL 299

  Fly   301  300
            plant   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 56/260 (22%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.