DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP705A12

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_199072.1 Gene:CYP705A12 / 834265 AraportID:AT5G42580 Length:499 Species:Arabidopsis thaliana


Alignment Length:488 Identity:101/488 - (20%)
Similarity:194/488 - (39%) Gaps:104/488 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVEICLVLATIGLLLFKWSTGTFKAFEGRNLYFEKP-----YPFLG---NMAASALQKASFQKQI 59
            |:.:||.......|.||...|           |:.|     .|.:|   ::.:|:|...|||| :
plant    15 FILLCLFSFLCYALFFKKPKG-----------FDLPPSPPSLPIIGHLHHLLSSSLPHKSFQK-L 67

  Fly    60 SEFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLV---NDMLNV 121
            |..|....|   :.:||.  ||:.::...:..:: .:..|...:::.:.:..:.||   :..:..
plant    68 SFKYGPLLH---LRIFNF--PMVLVSSASMAYEV-FRTNDVNVSYRFVPVNKDSLVFGSSGFVTA 126

  Fly   122 MRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQ-----CLEHLKSSQPIAAGENAFELDMKVL 181
            ....:|:.|:.:::   |.....:...|...:.|:     ||:    .|..|..:.:.|:....|
plant   127 PYGDYWKFMKKLIS---TKLLRPHALELSKGNRAEELRRFCLD----LQGKARKKESVEIGKVAL 184

  Fly   182 CNKLSNDVIATTAFGLKVNSFDD-PENEFHTIGKTLAFSRGLPFLKFMMCLLAPKVF--NFFKLT 243
              ||:|::|...:.|...:..:. .|.....:.|:.|              |:.|:|  |.|:..
plant   185 --KLTNNIICRMSMGRSCSEKNGVAERARELVNKSFA--------------LSVKLFFSNMFRKD 233

  Fly   244 I------FDSTNVEYFVRLVVDAMQYREKHNITRP---DMIQLLMEA--KKESKDNWTDDEIVAQ 297
            |      ||    |:..|::|:     .:.|:...   |||..|:||  .:|::...|..:|.:.
plant   234 IMGVSREFD----EFLERILVE-----HEENLEGDQDRDMIDHLLEAYRNEEAEYKITRKQIKSL 289

  Fly   298 CFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDA-AQEMTYMDMVI 361
            ....|....::::..|..|..|:|.|..:.|:|..|:   ...:.|..|..:: ...:.|:..|:
plant   290 IVEIFLGGTDSSAQTIQWTMAEILNNPGVLEKLRAEI---DSVVGGKRLIQESDLPNLPYLQAVV 351

  Fly   362 SESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGD--NINIPICGLHWDERFFPQPQRFDPE 424
            .|.||....:....|:..        |..::.||...:  .:.:.:..::.|...:..|..|.||
plant   352 KEGLRLHPSAPVLLRVFG--------ESCEVKEFYVPEKTTLVVNLYAVNRDPDSWEDPDMFKPE 408

  Fly   425 RF--------SERRKKDLIPYTYLPFGVGPRSC 449
            ||        .|:.::..:  .|:.||.|.|:|
plant   409 RFLVSSISGDEEKIREQAV--KYVTFGGGRRTC 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 93/454 (20%)
CYP705A12NP_199072.1 CYP93 72..490 CDD:410748 82/419 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.