DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP714A2

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_197872.1 Gene:CYP714A2 / 832559 AraportID:AT5G24900 Length:525 Species:Arabidopsis thaliana


Alignment Length:508 Identity:114/508 - (22%)
Similarity:193/508 - (37%) Gaps:124/508 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PYPFLGNMAASALQKASFQKQ-------ISEFYNRT------RHHKLVG-LFNLRTPMIQ---IN 85
            |.|.:.|...|.:|:...:.:       ||..|:.:      ...|..| ::...|.:.|   ||
plant    50 PPPSIFNGNVSEMQRIQSEAKHCSGDNIISHDYSSSLFPHFDHWRKQYGRIYTYSTGLKQHLYIN 114

  Fly    86 DPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLN--------VMRDQHWRNMRSVLTPVFTSAK 142
            .|:::|::        ....|||:.....:...||        .....||.:.|.::...||..|
plant   115 HPEMVKEL--------SQTNTLNLGRITHITKRLNPILGNGIITSNGPHWAHQRRIIAYEFTHDK 171

  Fly   143 MRNMFTLMNESFAQCL----EHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKVNSFD 203
            ::.|..||.||....|    |.:|     ..||...::.:......:|.||||...||       
plant   172 IKGMVGLMVESAMPMLNKWEEMVK-----RGGEMGCDIRVDEDLKDVSADVIAKACFG------- 224

  Fly   204 DPENEFHTIGKTLAFSRGLPFLKFMMCLLAPKV-------FNFFKLTIFDST---NVEYFVRLVV 258
                        .:||:|......:..||....       ||.|...:|.|.   :|:      :
plant   225 ------------SSFSKGKAIFSMIRDLLTAITKRSVLFRFNGFTDMVFGSKKHGDVD------I 271

  Fly   259 DAMQYREKHNI--------------TRPDMIQLLMEAKKESKDN--WTDDE----IVAQCFIFFF 303
            ||::...:.:|              .:.|::||::|....|.|.  |....    :|..|...:|
plant   272 DALEMELESSIWETVKEREIECKDTHKKDLMQLILEGAMRSCDGNLWDKSAYRRFVVDNCKSIYF 336

  Fly   304 AAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMVISESLRKW 368
            |..::.:..:......|..|...|.::.:|:  ......|.| ..::...:..:.|||.|::|.:
plant   337 AGHDSTAVSVSWCLMLLALNPSWQVKIRDEI--LSSCKNGIP-DAESIPNLKTVTMVIQETMRLY 398

  Fly   369 TLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIP--IC------GLHWD-ERFFPQPQRFDPE 424
            ..:....|..:||..|.|              :.:|  :|      .||.| |.:.|....|.||
plant   399 PPAPIVGREASKDIRLGD--------------LVVPKGVCIWTLIPALHRDPEIWGPDANDFKPE 449

  Fly   425 RFSERRKKDL-IPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASP 476
            ||||...|.. .|.:|:|||:|||:|:|..:.:|:.|.::..::..:....||
plant   450 RFSEGISKACKYPQSYIPFGLGPRTCVGKNFGMMEVKVLVSLIVSKFSFTLSP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 114/508 (22%)
CYP714A2NP_197872.1 p450 37..524 CDD:299894 114/508 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.