DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP709B3

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 / 828885 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana


Alignment Length:547 Identity:130/547 - (23%)
Similarity:228/547 - (41%) Gaps:96/547 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LATIGLLLFK----WSTGTF---------KAFEGRNLYFEKPYPFLGNMAASALQKASFQKQI-- 59
            |.||.||||.    |.....         |.|:.:.:...|.....||:  |.::|...:..:  
plant     9 LLTIVLLLFVVSKIWKACWILLLRPLMLSKRFKKQGISGPKYKILYGNL--SEIKKMKKEADLCV 71

  Fly    60 -----SEFYNRT--RHHKLVG------LFNLRT-PMIQINDPQLIKKICVKDFDHFPNHQTLNIP 110
                 ::.:.|.  ::|:.:.      ||...| |.|.|::.:|.|::....|..     |: ||
plant    72 LDPNSNDIFPRVFPQYHQWMSQYGDTFLFWTGTKPTIYISNHELAKQVLSSKFGF-----TI-IP 130

  Fly   111 NER-----LVNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAG 170
            .:|     |....|:.::...|...|.:|.|.|:..:::.|...|.:...:..|..:..:  ..|
plant   131 VKRPEVFILFGKGLSFIQGDDWIRHRRILNPAFSMDRLKAMTQPMGDCTLRIFEEWRKQR--RNG 193

  Fly   171 ENAFELDMKVLCNKLSNDVIATTAF------GLKVNSFDDPENEFHTIGKTLAFSRGLPFL---- 225
            |...::::....:||:.|:||||||      |:::........:::....|..|..|..:|    
plant   194 EVLIKIEISKEFHKLTADIIATTAFGSSYAEGIELCRSQTELEKYYISSLTNVFIPGTQYLPTPT 258

  Fly   226 KFMMCLLAPKVFNFFKLTIFDSTNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKK--ESKDN 288
            ...:..|..||.|..|             |::...::.:.|......|::.:::.|.|  |.:..
plant   259 NLKLWELHKKVKNSIK-------------RIIDSRLKSKCKTYGYGDDLLGVMLTAAKSNEYERK 310

  Fly   289 WTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQE 353
            ...|||:.:|..|::|.....|.|:..|...|..:...||:|.|||  ..|..|......|...:
plant   311 MRMDEIIEECKNFYYAGQGTTSILLTWTTMLLSLHQGWQEKLREEV--FNECGKDKIPDTDTFSK 373

  Fly   354 MTYMDMVISESLRKW----TLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERF 414
            :..|:||:.||||.:    .:|..|          |.|......|...|.:|.||:..:|.|:..
plant   374 LKLMNMVLMESLRLYGPVIKISREA----------TQDMKVGHLEIPKGTSIIIPLLKMHRDKAI 428

  Fly   415 FPQ-PQRFDPERFSERRKKDLI-PYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASP- 476
            :.: .::|:|.||.....:..| |...|||.:|||:||...:|:::||.:|..::..:::..|| 
plant   429 WGEDAEQFNPLRFENGISQATIHPNALLPFSIGPRACIAKNFAMVEAKTVLTMILQQFQLSLSPE 493

  Fly   477 --RTTRDMWESARGFNIIPTTGFWMQL 501
              .|..|      .|::.|..|..:.|
plant   494 YKHTPVD------HFDLFPQYGLPVML 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 114/482 (24%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 130/547 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.