DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP71A27

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 / 827771 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana


Alignment Length:472 Identity:104/472 - (22%)
Similarity:176/472 - (37%) Gaps:106/472 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFVEICLVLATIGLLLF-----KWSTGTFKAFEGRNLYFEKP--------YPFLGNMAASALQK 52
            |..:.|.|.|.|:...||     |..|.|            ||        .|.:||:.......
plant     1 MEMILISLCLTTLLAFLFLKPLLKRITTT------------KPKLPPSPWRLPVIGNLHQLGPNP 53

  Fly    53 ASFQKQISEFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICVKDFD-HFPNHQTLNIPNERLVN 116
            ..:...:|     .|:..|:.|...|.|::.::.|.:...| :|..| .|.|.     |..:.:|
plant    54 HRYLHSLS-----LRYGPLMLLHFGRVPVLVVSCPDVTNDI-MKTHDLKFANR-----PKSKAIN 107

  Fly   117 DMLNVMRD-------QHWRNMRSV-LTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENA 173
            ..:...||       :.|::|:|: :..:..:..:|:...|..|......|.|:.     |..::
plant   108 IFMEGGRDIIFGPYGEDWKSMKSLGVVHLLNNKMVRSFENLREEEIKVMTEKLEE-----ASSSS 167

  Fly   174 FELDMKVLCNKLSNDVIATTAFGLKVNSFDDPENEFHTIGKTLAFSRGLPFLKFMMCLLAP---- 234
            ..:::..|...|:||:|.....|.|.|     |.|.....|.|..:....|.||......|    
plant   168 SSVNLSKLLMTLTNDIICRITLGRKYN-----EEEGGIDIKNLVMTSSEFFGKFFFGDFIPSLAW 227

  Fly   235 -----------KVFNFFKLTIF-DSTNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKKESKD 287
                       |..| .||..| ||...|:     ||| .::|..:..  ||: ||::..|..:.
plant   228 IDWISGIDDKMKDIN-NKLDCFLDSMVQEH-----VDA-DHKEPSDFI--DML-LLIQKDKTKRF 282

  Fly   288 NWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQ 352
            .:...:::......||:.....::.:..|..||:|:.:..::|.:|:...  :.....:|....:
plant   283 KFDRSDLILILKDMFFSGTATTASQLEWTMTELMRHPECMKKLQDEINSF--STHNLNVTEKEVE 345

  Fly   353 EMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNI---------NIPICGL 408
            :|.|:..||.|.||.........||.::|..|      |.::..||.::         |..|.||
plant   346 KMNYLHCVIKEGLRLHPSGPLLFRLPSEDVQL------KGYDISAGTHVIINAWALQRNPAIWGL 404

  Fly   409 HWDERFFPQPQRFDPER 425
            ..:|        :.|||
plant   405 DANE--------YRPER 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 94/431 (22%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 92/428 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.