DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP72A14

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_188086.1 Gene:CYP72A14 / 820696 AraportID:AT3G14680 Length:512 Species:Arabidopsis thaliana


Alignment Length:477 Identity:114/477 - (23%)
Similarity:199/477 - (41%) Gaps:80/477 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PFLGNMAASALQKASFQKQISEFYN--------------RTRHH-----KLVGLFNLR----TPM 81
            |.:|:          |:|.||.|..              |...|     |..|..||.    .|.
plant    51 PLIGD----------FKKMISMFIEATSKPIKPTDDITPRVMPHPLQMLKTHGRTNLTWFGPIPT 105

  Fly    82 IQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNM 146
            |.|.||:.||::..|.:|....|   ..|..:::...|.......|...|.::.|.|...|::||
plant   106 ITIMDPEQIKEVFNKVYDFQKAH---TFPLSKILGTGLVSYDGDKWAQHRRIINPAFHLEKIKNM 167

  Fly   147 FTLMNESFAQCLEHLKSSQPIAAGE-NAFELDMKVLCNKLSNDVIATTAFGLKVNSFDDPENEFH 210
            ..:.:||   |.|.:.....:.:.: ::.|:|:......::.|||:.||||   :|:    .|.|
plant   168 VHVFHES---CSELVGEWDKLVSDKGSSCEVDVWPGLTSMTADVISRTAFG---SSY----REGH 222

  Fly   211 TIGKTLAFSRGL---PFLKFMM--CLLAPKVFNFFKLTIFDSTNVEYFVRLVVDAMQ-YREKHNI 269
            .|.:..|....|   .|.||.:  .:..|...|....|.  :..::..:|.:::..: .||....
plant   223 RIFELQAELAQLVMQAFQKFFIPGYIYLPTKGNRRMKTA--AREIQDILRGIINKRERARESGEA 285

  Fly   270 TRPDMIQLLMEAK--KESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYE 332
            ...|::.:|:|:.  :...:..:.::::.:|.:|:.|..|..|.|:..|...|.::.|.|.|..|
plant   286 PSEDLLGILLESNLGQTEGNGMSTEDMMEECKLFYLAGQETTSVLLVWTMVLLSQHQDWQARARE 350

  Fly   333 EVKET----QEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLF 393
            |||:.    |...:|       ..::..|.|::.|.||.:.......|...|:..|.|      .
plant   351 EVKQVFGDKQPDTEG-------LNQLKVMTMILYEVLRLYPPVVQLTRAIHKEMKLGD------L 402

  Fly   394 EFKAGDNINIPICGLHWD-ERFFPQPQRFDPERFSE---RRKKDLIPYTYLPFGVGPRSCIGNRY 454
            ....|..|::|:..:|.| |.:......|.||||.:   :..|:.:  ::.||..|||.|||..:
plant   403 TLPGGVQISLPVLLVHRDTELWGNDAGEFKPERFKDGLSKATKNQV--SFFPFAWGPRICIGQNF 465

  Fly   455 AVMQAKGMLYNLMLNYKIEASP 476
            .:::||..:..::..:..|.||
plant   466 TLLEAKMAMSLILQRFSFELSP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 114/477 (24%)
CYP72A14NP_188086.1 p450 24..512 CDD:299894 114/477 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.