DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP72A13

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_188084.1 Gene:CYP72A13 / 820694 AraportID:AT3G14660 Length:512 Species:Arabidopsis thaliana


Alignment Length:426 Identity:98/426 - (23%)
Similarity:183/426 - (42%) Gaps:71/426 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPVFTSAKMR 144
            |.|.|.||:.||::..|.:|....|   ..|..||:...|.......|...|.::.|.|...|::
plant   104 PTITIMDPEQIKEVFNKVYDFQKAH---TFPLGRLIAAGLVSYDGDKWTKHRRIINPAFHLEKIK 165

  Fly   145 NMFTLMNESFAQCLEHL-KSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKVNSFDDPENE 208
            ||....::|   |.|.: :..:.:...:::.|:|:......::.|||:.||||   :|:.:.:..
plant   166 NMVPAFHQS---CSEIVGEWDKLVTDKQSSCEVDIWPWLVSMTADVISRTAFG---SSYKEGQRI 224

  Fly   209 FHTIGKTLAFSRGLPFLKFMMCLLAPKVFNFFKLTIFD----------------STNVEYFVRLV 257
            |.                 :...||..:...|:..|..                :..:::.:|.:
plant   225 FE-----------------LQAELAQLIIQAFRKAIIPGYRYFPTKGNRRMKAAAREIKFILRGI 272

  Fly   258 VD-AMQYREKHNITRPDMIQLLMEAK-KESKDN-WTDDEIVAQCFIFFFAAFENNSNLICTTAYE 319
            |: .::.||.......|::.:|:|:. .::|.| .:.:|::.:|.:|:||..|..:.|:..|...
plant   273 VNKRLRAREAGEAPSDDLLGILLESNLGQTKGNGMSTEELMEECKLFYFAGQETTTVLLVWTMVL 337

  Fly   320 LLRNLDIQERLYEEVKET-----QEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCA 379
            |.::.|.|.|..||||:.     .:|        :...::..|.|::.|.||.:.......|...
plant   338 LSQHQDWQARAREEVKQVFGDKEPDA--------EGLNQLKVMTMILYEVLRLYPPVVQLTRAIH 394

  Fly   380 KDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQ-RFDPERFSE---RRKKDLIPYTYL 440
            |:..|.|      .....|..|::||..:..|...:.... .|.|:||.:   :..|:.:  ::.
plant   395 KEMQLGD------LTLPGGVQISLPILLIQRDRELWGNDAGEFKPDRFKDGLSKATKNQV--SFF 451

  Fly   441 PFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASP 476
            ||..|||.|||..:|:::||..:..::..:..|.||
plant   452 PFAWGPRICIGQNFALLEAKMAMTLILRKFSFELSP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 98/426 (23%)
CYP72A13NP_188084.1 p450 24..512 CDD:299894 98/426 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.