DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP72A8

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_188080.1 Gene:CYP72A8 / 820690 AraportID:AT3G14620 Length:515 Species:Arabidopsis thaliana


Alignment Length:520 Identity:120/520 - (23%)
Similarity:218/520 - (41%) Gaps:90/520 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLATIGLLLFKWSTGTFKAFEGRNLYFEK------PYPFL-GNM---AASALQKASFQKQISEF 62
            :|:.|:.:.::|.....:...:....|.::      |:.|| |::   |:...|:.|....:::.
plant    16 VVVTTVTVWIWKGLNVAWLRPKKNEAYLKRQGLSGTPFTFLVGDIKREASMVEQEKSRPINLTDD 80

  Fly    63 YNRTRHHKLVGLFNLRTPMIQ---------------------INDPQLIKKIC--VKDFDHFPNH 104
            |.    |:::       |:||                     :..|:.||.:.  |.||...|.|
plant    81 YT----HRVM-------PLIQQTVKDHGKTSYMWMGPIASVIVTKPEHIKDVLNRVYDFPKPPVH 134

  Fly   105 QTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAA 169
                 |...|....:.:...:.|...|.::.|.|...|::.|.....||   |.|.:...:.:..
plant   135 -----PIVELFATGVALYEGEKWSKHRKIINPSFHLEKLKIMIPAFYES---CSEMISKWEKLVT 191

  Fly   170 GE-NAFELDMKVLCNKLSNDVIATTAFGLKVNS----FDDPENEFHTIGKT--LAFSRGLPFLKF 227
            .: ::.|:|:......|::|||:.||||.....    |:..|.:...:.|.  |||..|:.||  
plant   192 EQGSSNEIDVWPYLGDLTSDVISRTAFGSSYEEGKRIFELQEEQGRRVLKALELAFIPGMRFL-- 254

  Fly   228 MMCLLAPKVFNFFKLTIFDSTNVEYFVRL---VVDAMQYREKHNITRPDMIQLLMEAKKESKDN- 288
                  |...|.....|    |.|...||   ::...:..:.....:.|::.:|:|:  .|.|: 
plant   255 ------PTKNNLRMRQI----NKEVKSRLREIIMKRQRGMDTGEAPKNDLLGILLES--NSGDHG 307

  Fly   289 WTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQE 353
            .:.:::|.:|.:|.||..|..:.|:..|...|..:...|::..||:.:.  ..|.....:||...
plant   308 MSIEDVVEECRLFHFAGQETTAVLLVWTMIMLSHHQKWQDQAREEILKV--IGKNNKPNFDALSR 370

  Fly   354 MTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQP 418
            :..|.|:::|.||.:.......|...|:..|.:|     .....|..:.||:..:|.|...:.:.
plant   371 LKTMSMILNEVLRLYPPGILLGRTVEKETKLGED-----MTLPGGAQVVIPVLMVHRDPELWGED 430

  Fly   419 -QRFDPERFSE---RRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPRTT 479
             ..|:||||::   :..|:.:  ::||||.|||.|.|..:|:|:||..|..::..:..|.||..|
plant   431 VHEFNPERFADGISKATKNQV--SFLPFGWGPRFCPGQNFALMEAKMALVLILQRFSFELSPSYT 493

  Fly   480  479
            plant   494  493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 115/488 (24%)
CYP72A8NP_188080.1 p450 26..515 CDD:299894 118/510 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.