DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP72A7

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_188079.1 Gene:CYP72A7 / 820689 AraportID:AT3G14610 Length:512 Species:Arabidopsis thaliana


Alignment Length:427 Identity:109/427 - (25%)
Similarity:186/427 - (43%) Gaps:72/427 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PMIQINDPQLIKKIC--VKDFDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPVFTSAK 142
            |.|.|.:|:.||::.  |.||:     :....|..||:...|...:...|.:.|.::.|.|...|
plant   103 PTIVITNPEQIKEVFNKVNDFE-----KASTFPLIRLLAGGLASYKGDKWASHRRIINPAFHLEK 162

  Fly   143 MRNMFTLMNESFAQCLEHLKSSQPIAAGENAF-------ELDMKVLCNKLSNDVIATTAFGLKVN 200
            ::||.    .:|..|     .|:.:...|..|       |:|:......::.|||:.||||   :
plant   163 IKNMI----PAFYHC-----CSEVVCQWEKLFTDKESPLEVDVWPWLVNMTADVISHTAFG---S 215

  Fly   201 SFDDPENEFHTIGK-----TLAFSRG-LPFLKFMMCLLAPKVFNFFKLTIFDSTNVEYFVRLVVD 259
            |:.:.:..|...|:     ..||.:. :|..:|.     |...| .::...| ..|:..:|.:|.
plant   216 SYKEGQRIFQLQGELAELIAQAFKKSYIPGSRFY-----PTKSN-RRMKAID-REVDVILRGIVS 273

  Fly   260 AMQ-YREKHNITRPDMIQLLMEA-KKESKDN-WTDDEIVAQCFIFFFAAFENNSNLICTTAYELL 321
            ..: .||.......|::.:|:|: .:||:.| .:.::::.:|.:|:||..|..|.|:..|...|.
plant   274 KREKAREAGEPANDDLLGILLESNSEESQGNGMSVEDVMKECKLFYFAGQETTSVLLVWTMVLLS 338

  Fly   322 RNLDIQERLYEEV--------KETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLC 378
            .:.|.|.|..|||        |...|:|          ..:..|.|:.:|.||.:...|...|:.
plant   339 HHQDWQARAREEVMQVLGENNKPDMESL----------NNLKVMTMIFNEVLRLYPPVAQLKRVV 393

  Fly   379 AKDYTLTDDEGTKLFEFKAGDNINIPICGLHWD-ERFFPQPQRFDPERFSE---RRKKDLIPYTY 439
            .|:..|.:      ....||..|.:|...:..| |.:......|.||||.:   :..|:.:  ::
plant   394 NKEMKLGE------LTLPAGIQIYLPTILVQRDTELWGDDAADFKPERFRDGLSKATKNQV--SF 450

  Fly   440 LPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASP 476
            .|||.|||.|||..:|:::||..:..::..:..|.||
plant   451 FPFGWGPRICIGQNFAMLEAKMAMALILQKFSFELSP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 109/427 (26%)
CYP72A7NP_188079.1 p450 21..512 CDD:299894 109/427 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.