DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP711A1

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_565617.2 Gene:CYP711A1 / 817157 AraportID:AT2G26170 Length:522 Species:Arabidopsis thaliana


Alignment Length:432 Identity:102/432 - (23%)
Similarity:196/432 - (45%) Gaps:68/432 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 RTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDM----LNVMRDQHWRNMRSVLTPVF 138
            |.|:|.|.:.:|.:::.:|.|...||.   :||:....:.:    |...||:.|..||:.:..::
plant    86 RQPLIIIAEAELCREVGIKKFKDLPNR---SIPSPISASPLHKKGLFFTRDKRWSKMRNTILSLY 147

  Fly   139 TSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFG------- 196
            ..:.:.::...|: ||.....|...|:|       .::....|..||:.|:|...|||       
plant   148 QPSHLTSLIPTMH-SFITSATHNLDSKP-------RDIVFSNLFLKLTTDIIGQAAFGVDFGLSG 204

  Fly   197 ------LKVNSFDDPENEFHTIGKTLAFSRGLPFLKFMMCLLAPKVFNFFKLTI----------F 245
                  ::|..|.: ::.:.|....:..|..   |..::.||.|.:...|:..:          .
plant   205 KKPIKDVEVTDFIN-QHVYSTTQLKMDLSGS---LSIILGLLIPILQEPFRQVLKRIPGTMDWRV 265

  Fly   246 DSTNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKKE---SKDNWTDDEIVAQCFIFFFAAFE 307
            :.||.....:|.....:..::......|.:.|:::|::.   :|:.:|.|.|.|..:....|...
plant   266 EKTNARLSGQLNEIVSKRAKEAETDSKDFLSLILKARESDPFAKNIFTSDYISAVTYEHLLAGSA 330

  Fly   308 NNSNLICTTAYELLRNLDIQERLYEEVK--ETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTL 370
            ..:..:.:..|.:..:||:::||.:|:.  ..::.:   |..:|...:..|:|.||.|::|.:.:
plant   331 TTAFTLSSVLYLVSGHLDVEKRLLQEIDGFGNRDLI---PTAHDLQHKFPYLDQVIKEAMRFYMV 392

  Fly   371 SAAADRLCAKD-----YTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERF--SE 428
            |....|..||:     |.|  .:||.::         :.:..|..|.:.||:|::|.||||  :.
plant   393 SPLVARETAKEVEIGGYLL--PKGTWVW---------LALGVLAKDPKNFPEPEKFKPERFDPNG 446

  Fly   429 RRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNY 470
            ..:|...||.::|||:|||:|:|.|:|:.:.|..|.:|..||
plant   447 EEEKHRHPYAFIPFGIGPRACVGQRFALQEIKLTLLHLYRNY 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 102/432 (24%)
CYP711A1NP_565617.2 cytochrome_P450 75..515 CDD:425388 102/432 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.