DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_077764.2 Gene:Cyp4f18 / 72054 MGIID:1919304 Length:524 Species:Mus musculus


Alignment Length:466 Identity:105/466 - (22%)
Similarity:179/466 - (38%) Gaps:90/466 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERL--------VNDMLNVMRDQHWRNMRSVLTP 136
            |:|:|..|..||.:.:.        ..|..|.:.:        :.|.|.:.....|...|.:|||
Mouse    97 PVIRIFHPAFIKPVVLA--------PALVAPKDTVFYRFLKPWLGDGLLMSTGDKWSRHRRMLTP 153

  Fly   137 VFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKVNS 201
            .|....::....:.|:|  ..:.|.| .|.:|:..:|: |:|....:.::.|.:....|....|.
Mouse   154 AFHFNILKPYVKVFNDS--TNIMHAK-WQRLASKGSAY-LNMFEHISLMTLDSLQKCVFSFDSNC 214

  Fly   202 FDDPENEFHTIGK--TLAFSRGLPFLKFMMCLLAPKVFNFFKLTIFDSTNVEYFVRLVVDAMQYR 264
            .:.|......|.:  ||...|....|                      .:|:.|..|..|.|::|
Mouse   215 QEKPSEYITAILELSTLVARRHQRLL----------------------LHVDLFYYLTHDGMRFR 257

  Fly   265 EK----HNITRP---------------------------DMIQLLMEAKKESKDNWTDDEIVAQC 298
            :.    |:.|..                           |.|.:|:.:|.|.....:|::|.|:.
Mouse   258 KACRLVHDFTDAVIRERRRTLLDQGGVDVLKAKAKAKTLDFIDVLLLSKDEHGKALSDEDIRAEA 322

  Fly   299 FIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMVISE 363
            ..|.|...:..::.:....|.|.|:.:.|||..:||:|.....:...:.:|...::.::.|.|.|
Mouse   323 DTFMFGGHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKE 387

  Fly   364 SLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSE 428
            |||......|..|.|.:|..|.|..     ....|....|.|.|.|.:...:|.|:.:||.||..
Mouse   388 SLRLHPPVTAISRCCTQDIVLPDGR-----VIPKGVISRISIFGTHHNPAVWPDPEVYDPFRFDA 447

  Fly   429 RRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKI---EASPRTTRDMWESARGFN 490
            ...|...|..::||..|||:|||..:|:.:.|..|...:|.:::   :..||...::...|.|  
Mouse   448 DNVKGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRVLPDDKEPRRKPELILRAEG-- 510

  Fly   491 IIPTTGFWMQL 501
                 |.|:::
Mouse   511 -----GLWLKV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 100/441 (23%)
Cyp4f18NP_077764.2 p450 52..516 CDD:365848 105/464 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.