DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp3a71-ps

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:XP_008767252.2 Gene:Cyp3a71-ps / 690383 RGDID:1597309 Length:183 Species:Rattus norvegicus


Alignment Length:168 Identity:38/168 - (22%)
Similarity:76/168 - (45%) Gaps:34/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKVNS 201
            :|||.|::.||.::.......:::|:..     .|....:.:|.:....|.|||.:|:||:.|:|
  Rat     1 MFTSGKLKVMFPIIKLYGDILVKYLRQE-----AEKGKPVSVKDIFGAYSMDVITSTSFGVNVDS 60

  Fly   202 FDDPENEFHTIGKTLAFSR------------GLPFLKFMMCLLAPKVFNFFKLTIFDSTNVEYFV 254
            .::|::.|  :.||..|.|            ..||||        .:::...:::|...::.:|.
  Rat    61 LNNPKDPF--VEKTKKFLRLDYFDPLFISVELFPFLK--------PIYDMLNISVFPKDSIAFFK 115

  Fly   255 RLVVDA----MQYREKHNITRPDMIQLLMEAKKESKDN 288
            ..|...    :..::|:.:   |..||:|.|...|.::
  Rat   116 NFVYSMKESHLDSKQKYQV---DFFQLMMNAHNNSSES 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 38/168 (23%)
Cyp3a71-psXP_008767252.2 cytochrome_P450 2..>153 CDD:425388 38/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.