DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4f37

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001093657.1 Gene:Cyp4f37 / 677156 MGIID:3780112 Length:546 Species:Mus musculus


Alignment Length:446 Identity:97/446 - (21%)
Similarity:177/446 - (39%) Gaps:50/446 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPVFTSAKMR 144
            |:::|.||..:..:.:......|...|.:...:..:.|.|.:.....|...|.:|||.|....::
Mouse    97 PVLRIVDPAFVAPLLLASALVAPKDTTFHTFVKPWLGDGLFLNSGDKWSRHRRLLTPAFHFDILK 161

  Fly   145 NMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKVNSFDDPENEF 209
            ....:.|:|..  :.|.|...  .:.|.:..|:|....:.::.|.:....||...|..:.|....
Mouse   162 PYVKIFNQSVN--IMHAKWKH--LSSEGSARLEMFEHISLMTLDSLQKCLFGFDSNCQESPSEYI 222

  Fly   210 HTIGKTLAFSRGLPFLKFMMCLLAPKVFNFFKLTIFDSTNVEYF------VRLVVDAMQYREKHN 268
            ..|.:          |..::...:.::|.|.....:.:.:...|      |....||:....:|.
Mouse   223 SAILE----------LSSLVIKRSHQLFLFVDFLYYHTADGRRFRKACDLVHNFTDAVIRERRHT 277

  Fly   269 ITRP---------------DMIQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAY 318
            ::..               |.|.:|:.||.|.....:|::|.|:...|.|...:..::.:....|
Mouse   278 LSSQNHDEFLKSKTKSKTLDFIDVLLLAKDEHGKELSDEDIRAEADTFMFGGHDTTASALSWILY 342

  Fly   319 ELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYT 383
            .|.|:.:.|||..:||:|.....:...:.:|...::.::.|.|.||||.........|.|.:|..
Mouse   343 NLARHPEYQERCRQEVQELLRGREPQEIEWDDLAQLPFLTMCIKESLRLHPPVIDLLRRCTRDIV 407

  Fly   384 LTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRS 448
            |.|..     ....|:...|.|.|:|.:...:|.|:.:||.||.........|..::||..|||:
Mouse   408 LPDGR-----VIPKGNICVISIFGIHHNPSVWPDPEVYDPFRFDPENAHKRPPLAFIPFSAGPRN 467

  Fly   449 CIGNRYAVMQAKGMLYNLMLNYKI---EASPRTTRDMWESARGFNIIPTTGFWMQL 501
            |||..:|:.:....|...:|.::|   :..||...::...|.|       |.|:::
Mouse   468 CIGQTFAMNEMMVALALTLLRFRILPDDKEPRRKPEIILRAEG-------GLWLRV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 92/421 (22%)
Cyp4f37NP_001093657.1 CYP4F 74..515 CDD:410772 97/443 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.