DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4a31

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_964002.2 Gene:Cyp4a31 / 666168 MGIID:3028580 Length:509 Species:Mus musculus


Alignment Length:411 Identity:99/411 - (24%)
Similarity:175/411 - (42%) Gaps:63/411 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCN 183
            |.::..|.|...|.:|||.|....::.....|.:|....|:   ..:.:|..:::.|:...:  :
Mouse   130 LLLLNGQSWFQHRKMLTPAFHYDILKTYVKNMADSIRLMLD---KWERLAGQDSSIEIFQHI--S 189

  Fly   184 KLSNDVIATTAFGLK------------VNSFDDPENEFH-----------TIGKTLAFSRGLPFL 225
            .::.|.:...||..|            :.:..|..|..|           ||.|..:..|    |
Mouse   190 LMTLDTVMKCAFSHKGSVQVDGNYKTYLQAIGDLNNLVHSRVRNMFHQNDTIYKLSSNGR----L 250

  Fly   226 KFMMCLLAPKVFNFFKLTIFDSTNVEYFVRLVVDAMQYR-EKHNI---TRPDMIQLLMEAKKESK 286
            ....|.||           .|.|  :..:::..|.:|.. |..||   .|.|.:.:|:.|:.|::
Mouse   251 SNQACQLA-----------HDHT--DGVIKMRKDQLQDEGELENIKKKRRLDFLDILLFARMENE 302

  Fly   287 DNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEAL-KGAPLTYDA 350
            |:.:|.::.|:...|.....:..::.:....|.|..:.:.|:|..|||   |..| .|:.:|:|.
Mouse   303 DSMSDKDLRAEVDTFMIEGHDTTASGVSWIFYALATHPEHQQRCREEV---QSLLGDGSSITWDH 364

  Fly   351 AQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFF 415
            ..::.|..|.|.|:||.:....:..|..:...|..|  |..|   ..|..:.:.|.|||.:.:.:
Mouse   365 LDQIPYTTMCIKEALRLYPPVPSIGRELSTSVTFPD--GCSL---PKGVQVTLSIYGLHHNPKVW 424

  Fly   416 PQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPRTTR 480
            |.|:.|||.||:....:.  .:::|||..|.|:|||.::|:.:.|.::...:|.:  |..|..||
Mouse   425 PNPEVFDPSRFAPDSPRH--SHSFLPFSGGARNCIGKQFAMSELKVIVALTLLRF--ELLPDPTR 485

  Fly   481 DMWESARGFNIIPTTGFWMQL 501
            .....|| |.:....|.::.|
Mouse   486 VPMSLAR-FVLKSKNGIYLHL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 92/386 (24%)
Cyp4a31NP_964002.2 p450 52..503 CDD:278495 98/407 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.