DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP4F11

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:423 Identity:92/423 - (21%)
Similarity:167/423 - (39%) Gaps:74/423 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 VNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMK 179
            :.|.|.:.....|...|.:|||.|....::....:.|:|..  :.|.|..:  .|.|.:..|||.
Human   132 LGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVN--IMHDKWQR--LASEGSARLDMF 192

  Fly   180 VLCNKLSNDVIATTAFGLKVNSFDDPENEFHTIGKTLAF--SRGLPFLKFMMCLLAPKVFNFFKL 242
            ...:.::.|.:....|..:.|..:.|......|.:..||  .|....|                 
Human   193 EHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQIL----------------- 240

  Fly   243 TIFDSTNVEYFVRLVVDAMQYR--------------EKHNITRP-----------------DMIQ 276
                 .:.::...|..|..::|              ::...|.|                 |.|.
Human   241 -----LHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFID 300

  Fly   277 LLMEAKKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEAL 341
            :|:.:|.|.....:|::|.|:...|.|...:..::.:....|.|.::.:.||:..:||:|..:..
Human   301 VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDR 365

  Fly   342 KGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPIC 406
            :...:.:|...::.::.|.|.||||.........|.|.:|:.|.|..     ....|....|.|.
Human   366 EPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGR-----VIPKGIVCLINII 425

  Fly   407 GLHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYK 471
            |:|::...:|.|:.:||.||.:...|:..|..::||..|||:|||..:|:.:.|.:|...:|:::
Human   426 GIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFR 490

  Fly   472 I---EASPRTTRDMWESARGFNIIPTTGFWMQL 501
            |   ...||...::...|.|       |.|:::
Human   491 ILPTHTEPRRKPELILRAEG-------GLWLRV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 87/398 (22%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 88/404 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.