DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4f1

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_062569.2 Gene:Cyp4f1 / 56266 RGDID:70926 Length:524 Species:Rattus norvegicus


Alignment Length:416 Identity:105/416 - (25%)
Similarity:167/416 - (40%) Gaps:60/416 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 VNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMK 179
            :.|.|.|.....|...|.:|||.|....::....:.|:|  ..:.|.|..:.|:.|.:  .|||.
  Rat   132 LGDGLLVSAGDKWSRHRRMLTPAFHFNILKPYVKIFNDS--TNIMHAKWKRLISEGSS--RLDMF 192

  Fly   180 VLCNKLSNDVIATTAFGLKVNSFDD--PENEFHTIGKTLAFS-----RGLPFLKFMMCL--LAPK 235
            ...:.::.|.:....|     |||.  .|.....|...|..|     |....|.||..|  |.|.
  Rat   193 EHVSLMTLDSLQKCVF-----SFDSNCQEKSSEYIAAILELSALVAKRHQQPLLFMDLLYNLTPD 252

  Fly   236 VFNFFKLTIFDSTNVEYFVRLVVDAMQYREKHNITRP-----------------DMIQLLMEAKK 283
            ...|.|     :.|:   |....||: .||:.. |.|                 |.|.:|:..|.
  Rat   253 GMRFHK-----ACNL---VHEFTDAV-IRERRR-TLPDQGLDEFLKSKAKSKTLDFIDVLLLTKD 307

  Fly   284 ESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTY 348
            |.....:|::|.|:...|.|...:..::.:....|.|.::.:.|||..:||:|.........:.:
  Rat   308 EDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLAKHPEYQERCRQEVQELLRDRDPEEIEW 372

  Fly   349 DAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDER 413
            |...::.::.|.|.||||.........|.|.:|..|.|..     ....|....|.|.|:|.:..
  Rat   373 DDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGR-----TIPKGIICLISIFGIHHNPS 432

  Fly   414 FFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKI---EAS 475
            .:|.|:.::|.||.....||..|..::||..|||:|||..:|:.:.|..|...:|.:::   :..
  Rat   433 VWPDPEVYNPFRFDPENIKDSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRLLPDDKE 497

  Fly   476 PRTTRDMWESARGFNIIPTTGFWMQL 501
            ||...::...|.|       |.|:::
  Rat   498 PRRQPELILRAEG-------GLWLRV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 100/391 (26%)
Cyp4f1NP_062569.2 CYP4F 74..515 CDD:410772 105/413 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.