DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP4F3

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:459 Identity:106/459 - (23%)
Similarity:180/459 - (39%) Gaps:64/459 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 HKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSV 133
            |.:|.:|:          |..||.:........|..:......:..:.|.|.:...:.|...|.:
Human    96 HAIVRIFH----------PTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRM 150

  Fly   134 LTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLK 198
            |||.|....::....:.|||    :..:.:...:.|.|.:..|||....:.::.|.:....|   
Human   151 LTPAFHFNILKPYMKIFNES----VNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVF--- 208

  Fly   199 VNSFDD--PENEFHTIGKTLAFSRGLPFLKFMMCLLAPKVFNFFKLTIFDSTNVEYFVRLVVD-- 259
              |||.  .|.....|...|..| .|...:....||   ..:|......|........|||.|  
Human   209 --SFDSHCQEKPSEYIAAILELS-ALVTKRHQQILL---YIDFLYYLTPDGQRFRRACRLVHDFT 267

  Fly   260 --AMQYREKHNITRP-----------------DMIQLLMEAKKESKDNWTDDEIVAQCFIFFFAA 305
              .:|.|.:   |.|                 |.|.:|:.:|.|.....:|::|.|:...|.|..
Human   268 DAVIQERRR---TLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEG 329

  Fly   306 FENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTL 370
            .:..::.:....|.|.::.:.|||..:||:|..:..:...:.:|...::.::.|.|.||||....
Human   330 HDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPP 394

  Fly   371 SAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLI 435
            ..|..|.|.:|..|.|..     ....|....|.:.|.|.:...:|.|:.:||.||..:..|:..
Human   395 VPAVSRCCTQDIVLPDGR-----VIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERS 454

  Fly   436 PYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKI---EASPRTTRDMWESARGFNIIPTTGF 497
            |..::||..|||:|||..:|:.:.|.:|...:|.:::   ...||...::...|.|       |.
Human   455 PLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLPDHTEPRRKPELVLRAEG-------GL 512

  Fly   498 WMQL 501
            |:::
Human   513 WLRV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 101/434 (23%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 106/456 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.